SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 458233.MCCL_1503 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  458233.MCCL_1503
Domain Number 1 Region: 131-306
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.07e-20
Family D-glucarate dehydratase-like 0.0014
Further Details:      
 
Domain Number 2 Region: 2-103
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 0.000000000667
Family Enolase N-terminal domain-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 458233.MCCL_1503
Sequence length 320
Comment (Macrococcus caseolyticus JCSC5402)
Sequence
MMKCTELNLYTYDAPFKVPIKTNLVQMRKRQVLVVGVVIDDVEYFAEVNSFETPWYHYET
IATSIENCKVIFNNLKHINIPSIEALQPYLKADAPNASSAFDVIAYQYFNPLKSVTVPIG
ETLHQGNNSFSHDAKRIKLKMHHHIVEQVQTIRESSNIPLVIDANGLLREDHFELLNTLS
QYDISYIEQPFKHIKLYDALLKRHPHIPLAIDESATDYAAIQLFRDIGVTTAVVKYSRIG
GITRVQSLPKQMTYVSGGMYEFGLSKYMTAMLGEQFGTVPDVTKRGTYFEHDFTTYHEVA
SDGCLTMTPPIVQKEQLTQL
Download sequence
Identical sequences B9E7P2
gi|222151750|ref|YP_002560906.1| 458233.MCCL_1503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]