SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 458817.Shal_0024 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  458817.Shal_0024
Domain Number 1 Region: 244-387
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.45e-36
Family Potassium channel NAD-binding domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1-162
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.85e-33
Family Potassium channel NAD-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 158-236
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.000000000301
Family TrkA C-terminal domain-like 0.01
Further Details:      
 
Domain Number 4 Region: 373-448
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.0000000144
Family TrkA C-terminal domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 458817.Shal_0024
Sequence length 469
Comment (Shewanella halifaxensis HAW EB4)
Sequence
MKIIILGAGQVGGTLAENLVGENNDITIVDHDKNRLRSLQDKYDLRVVVGHGAHPSVLKE
AGAEDADMLIAVTNSDECNMAACQIAYSLYGTPTKIARIRSEQYLGLRDKLFIDSETKNA
DNRPRGGFIIDELIAPEQLVTAYIGRLVEYPGALQVLEFAEGRLSLVAVRAYYGGPLVGN
ALAALREHMPNIDTRVAAIFRQGRPIMPRGTTIIEADDEVFFVADSRHVRAVMSEMQKLD
NSYRNIMIAGGGNIGLGLAKQLQRNHSVKLIERKQERAEELSERLENTTVFCGDASDQEL
LLEEHIDQTDVFIAVTNDDEANIMAALLAKRMGAKKVMVLIQREAYVDIVQEANIDIAIS
PQQATISALLTHIRQGDICNVYSLRRGAAEAIEAIAHGDSNTSKVVGKQISEIKLPPGTT
IGAIVRDEEVLMAHDKTVIEQGDHVILFLVNKKFIGEVEKLFQPSAFFF
Download sequence
Identical sequences B0TLC7
458817.Shal_0024 gi|167621965|ref|YP_001672259.1| WP_012275158.1.86919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]