SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 458817.Shal_0537 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  458817.Shal_0537
Domain Number - Region: 105-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00942
Family NfeD domain-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 458817.Shal_0537
Sequence length 159
Comment (Shewanella halifaxensis HAW EB4)
Sequence
MEFSNPILIWVCIGIFLMLTEIILPGGIVILIGAACLVVAGALAIGLVEGIVQSLTLWFI
AAMVLLLVFRQITQKLVGGDAHIDNTDEELDIYDQLATVKQTIGPAQQMGRVEFQGCEWS
ALGDGSEIAAGSVVRIICRDNIALVVEPIKAEDEHCAEK
Download sequence
Identical sequences B0TRE0
WP_012275666.1.86919 458817.Shal_0537 gi|167622477|ref|YP_001672771.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]