SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 458817.Shal_1189 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  458817.Shal_1189
Domain Number 1 Region: 22-150
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.00000000000000287
Family Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 458817.Shal_1189
Sequence length 177
Comment (Shewanella halifaxensis HAW EB4)
Sequence
MKKSTLLSLLLFTGFSHANITPLPELNEIKDYQQLNSKILTAGLPTETQFNTLSKAGVQL
VINLMPDEQKDSHADEAKLVTDAGMEYVYIPVDWINPKVEQVEAFFEVMDKNRDKDIIIH
CMANYRASAFAYLDQLRIGNKVSMEDTMMEWGDLQQSLQKHSQWAELIEQVKAKYNL
Download sequence
Identical sequences B0TJX1
gi|167623123|ref|YP_001673417.1| WP_012276300.1.86919 458817.Shal_1189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]