SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 458817.Shal_1643 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  458817.Shal_1643
Domain Number 1 Region: 42-229
Classification Level Classification E-value
Superfamily ClpP/crotonase 5.55e-23
Family Crotonase-like 0.06
Further Details:      
 
Weak hits

Sequence:  458817.Shal_1643
Domain Number - Region: 451-489
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000929
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 458817.Shal_1643
Sequence length 503
Comment (Shewanella halifaxensis HAW EB4)
Sequence
MLSNRLPAFISQLLIAALLQLTFCCGLSYATPTQESAITARPQVLVLAFEGAIGPATSEY
LTQGIERANVNAALGNGEIELIVIVMDTPGGLVSSLRDINQSILNSSVPIACLVAPPGAR
AASAGTYILYACHIAAMAEATTLGAATPVSIGPGSAPTPAPKQDPKDDDKSAPATPSAME
KKILNDSIAYIRALAQLRGRNEQWAELAVKEAATLTANEALEMNVINLISPDAPRLVAEL
TGWQVEIDHQQLTLALDNAELHYLKPDWRNRIISTVTNPNVAYILMLIGIYGILLEFYSP
GIGIAGITGAISLLVALYAFQMLPISYAGLGLLLLGIALITIESFAPSFGLFGIGGIVAF
AVGSLFLLDTKTDHFALSLPLIAAVSVTVTLGSLLVLGTLWRNRKSPIVSGDGQIVGQLA
LVTDDFTSSMQLTNASDTDVVNVTGNAQPTYKGFVLLQGEVWAASSLSPLKKAQQVTVVV
RHDLSLEVELSPVSNQQVLTKKC
Download sequence
Identical sequences B0TP52
458817.Shal_1643 gi|167623574|ref|YP_001673868.1| WP_012276747.1.86919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]