SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 458817.Shal_2416 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  458817.Shal_2416
Domain Number 1 Region: 22-149
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0000000000000042
Family Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 458817.Shal_2416
Sequence length 177
Comment (Shewanella halifaxensis HAW EB4)
Sequence
MKKSTLLSLLLFTGFSHANITPLPELNEIKDYQQLNSKILTAGLPTETQFNTLSKAGVQL
VINLMPDEQKDSHADEAKLVTDAGMEYVYIPVDWINPKVEQVEAFFEVMDKNRDKDIIIH
CMANYRASAFAYLDQLRIGNKVSMEDTMVEWGDLQQSLQKHSQWAELIEQVKAKYNL
Download sequence
Identical sequences B0TJH8
WP_012277502.1.86919 gi|167624339|ref|YP_001674633.1| 458817.Shal_2416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]