SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 460265.Mnod_3380 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  460265.Mnod_3380
Domain Number 1 Region: 34-217
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.32e-26
Family Clp protease, ClpP subunit 0.059
Further Details:      
 
Domain Number 2 Region: 398-455
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000824
Family NfeD domain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 460265.Mnod_3380
Sequence length 467
Comment (Methylobacterium nodulans ORS 2060)
Sequence
MQTAKAAFVAAMAIVALIVSLRPGSAEVSGSLALIISIDRAIGPASASYVKDALVTARER
RAEIIILRLNTPGGLNTSMREIIRDVLASSVPVVGYVAPSGAHAASAGTYILYATHIAAM
APGTNIGAATPVQIGGPIPGLPGGIPDKDGKDKKDGGRQPEAKDTMTAKATNDAVAFIRS
LAELRGRNADWAERAVREAATLSANGALQASVIDLVARDPAELLRQVDGRTVEVAGGKTQ
RLNTKYAILEAIDPGWISHFLTIIADPNVAFILLMIGIYGLIFEFMSPGAVAPGVVGTIC
LLLGLYSLNLLPINYAGFALMLIGIALLTIEAFNPTIVIGLGGVIAFVLGALMLFRVEAP
GYRLSWWVIGTTVAVFVGFVVVVLGSLRRAGKGPIRVGAQAMRGLPAEILDWSENEGHVL
AHGERWQARGAETFRPGETVEVANIIDLTLVVRRTSAPPETEAQHDA
Download sequence
Identical sequences B8IMB4
gi|220923301|ref|YP_002498603.1| WP_015929962.1.92880 460265.Mnod_3380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]