SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 460265.Mnod_4686 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  460265.Mnod_4686
Domain Number 1 Region: 124-366
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.32e-70
Family D-glucarate dehydratase-like 0.0001
Further Details:      
 
Domain Number 2 Region: 10-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.89e-26
Family Enolase N-terminal domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 460265.Mnod_4686
Sequence length 378
Comment (Methylobacterium nodulans ORS 2060)
Sequence
MSGAKETVSWIKLHSVYLPLTNPISDAKVLTGRQKPMTEIAILFCEVETSEGQRGLGFSY
SKRAGGPGQFAHAKEIAPALLGEDPNDIAKAWDKLAWAGASVGRSGLAVQAIGAFEVALW
DLKAKRAGLSLAKLLGAHRDSVRCYNTSGGFLHTPLEEVLANTTRSREKGIGGIKLKVGQ
PDWALDLKRVSAVRKHLGDAFPLMVDANQQWDRPTAQRMGRIFEQFNLIWIEEPLDCYDA
AGHAALAAQLDTPIATGEMLTSVAEHWDFIRQNGADFLMPDAPRVGGITPFLKVAALAEF
AGLTIAPHFSMELHIHLAAAMQREPWVEHFEWLEPLFNERLELKDGRMIVPTRPGLGVSM
SEQAIAWSRETAEFGRRA
Download sequence
Identical sequences B8IEI0
460265.Mnod_4686 gi|220924553|ref|YP_002499855.1| WP_015931187.1.92880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]