SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 460265.Mnod_6511 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  460265.Mnod_6511
Domain Number 1 Region: 139-422
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.42e-125
Family Enolase 0.0000000329
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.47e-56
Family Enolase N-terminal domain-like 0.00000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 460265.Mnod_6511
Sequence length 425
Comment (Methylobacterium nodulans ORS 2060)
Sequence
MTAITNIAARQILDSRGNPTVEVDVLLEDGSFGRAAVPSGASTGAHEAVELRDGDKARFG
GKGVLKAVAAVNGEILDAVGGMDAEDQVAVDEAMIELDGTPNKARLGANAILGVSLAVAK
AAAEASGLPLYRYVGGTQARVLPVPMMNIINGGAHADNPIDFQEFMIMPVGAASIAEAVR
MGAEVFQTLKGALKKAGHNTNVGDEGGFAPNLPSAEAALDFVMESIRAAGYAPGKDIVLA
LDCAATEFFKNGAYVYEGEGQTRDPEAQAAYLAKLADAYPILSIEDGMAEDDWQGWKALT
DKIGHRCQLVGDDLFVTNVARLSEGIAKGTANSILVKVNQIGSLTETLAAVDMAHRAGYT
AVMSHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEGLSGQARYAGR
AALKA
Download sequence
Identical sequences B8IDB4
gi|220926281|ref|YP_002501583.1| WP_015932853.1.92880 460265.Mnod_6511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]