SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 460265.Mnod_6549 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  460265.Mnod_6549
Domain Number - Region: 89-142
Classification Level Classification E-value
Superfamily NfeD domain-like 0.034
Family NfeD domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 460265.Mnod_6549
Sequence length 144
Comment (Methylobacterium nodulans ORS 2060)
Sequence
MLANLLAAIGPAWGWILFGLVLMAGELALPGVFLVWLGLGALLTGFLVGAVGPPWQAQVL
LFAALSGVAVLVGHRLSRARPDALNRRGSDLVGRIVVLDTAIEGGIGRIRVGDSVWRVTG
PDLPAGARVRITGLDGATLTVVAV
Download sequence
Identical sequences B8IDF2
460265.Mnod_6549 WP_015932890.1.92880 gi|220926319|ref|YP_002501621.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]