SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 460265.Mnod_7096 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  460265.Mnod_7096
Domain Number 1 Region: 145-419
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 8.59e-81
Family D-glucarate dehydratase-like 0.00000000169
Further Details:      
 
Domain Number 2 Region: 13-143
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.71e-33
Family Enolase N-terminal domain-like 0.00000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 460265.Mnod_7096
Sequence length 450
Comment (Methylobacterium nodulans ORS 2060)
Sequence
METPPRPALARGTPTITAMRVVPVAGRDSMLLNLSGAHGPFFTRNLVVLTDSTGATGLGE
VPGGERIRRTLEEARDLVLGQPLGAWNGVLNAMRTRFADRDAGGRGLQTFDLRVTIHAVT
AVESAFLDLLGRFLGVPVAALLGEGQQRDAVEMLGYLFYVGDRRRTNLPYREPEARDGWL
RLRDEEALTPETVVRLAEAAHERYGFNDFKLKGGVLPGEQEIEAVTAIAKRFPQARVTLD
PNGAWSLAEAIRLCKGRGDVLAYAEDPCGAEAGFSGREIMAEFRRATGLPTATNMIATDW
RQMVHALQLGAVDIPLADPHFWTLSGAVRVAQTCRDHGLTWGSHSNNHFDVSLAMFTHAA
AAAPGTVTAIDTHWIWQDGQRLTKEPLRIEGGRVKVPEQPGLGIDIDWAAVEAAHALYER
HGLGARDDAAAMQFLIPGWTFDPKRPCLVR
Download sequence
Identical sequences B8IJ41
WP_015933399.1.92880 gi|220926837|ref|YP_002502139.1| 460265.Mnod_7096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]