SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 465515.Mlut_12030 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  465515.Mlut_12030
Domain Number 1 Region: 88-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000157
Family NfeD domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 465515.Mlut_12030
Sequence length 158
Comment (Micrococcus luteus NCTC 2665)
Sequence
MEWIEANAGWLWLVLAAGLAGVELLTLDLVFLMIAAGAGAAGVVALVGGPPALQLAAFAA
VALLMLAAVRPVALRHLRKDTGAGASYLDTLPGRRVAAQGVITGDAGTLAVDGDTWSARV
EPGAPEVAPGDEVTVLRIDGATLVVRPLPRIDWEADGA
Download sequence
Identical sequences A0A2I1XUH4 C5CBW1
WP_010078649.1.25715 WP_010078649.1.54265 WP_010078649.1.79382 WP_010078649.1.79589 gi|239917704|ref|YP_002957262.1| 465515.Mlut_12030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]