SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 465817.ETA_10280 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  465817.ETA_10280
Domain Number 1 Region: 266-354
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000000000305
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0083
Further Details:      
 
Domain Number 2 Region: 23-139
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.000000000742
Family D-glucarate dehydratase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 465817.ETA_10280
Sequence length 373
Comment (Erwinia tasmaniensis)
Sequence
MHNEAPITRRKSKRIYVGKVPVGDGAPIAVQSMTNTRTTDVAATVAQIKALERVGVDIVR
VSVPTMDAAEAFRLIKQQVNVPLVADIHFDYRIALKVAEYGVDCLRINPGNIGNEERIRT
VVDCARHYNIPIRIGVNGGSLEKDLQEKYGEPTPQALLESAMRHVDHLDRLNFDMFKVSV
KASDVFLAVESYRLLAKQIDQPLHLGITEAGGARAGAVKSAIGLGLLLSEGIGDTLRISL
AADPVEEVKVGFDILKSLRIRARGINFIACPTCSRQEFDVIGTVNALEERLEDIITPMDI
SIIGCVVNGPGEATVSTMGVTGGSKKSGFYEDGVRLRERLDNDNMIDQLEARIRAKATIL
DAARRIDIQQVEK
Download sequence
Identical sequences B2VE89
WP_012440774.1.58220 465817.ETA_10280 gi|188533174|ref|YP_001906971.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]