SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 465817.ETA_24530 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  465817.ETA_24530
Domain Number 1 Region: 106-145
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000105
Family NfeD domain-like 0.0057
Further Details:      
 
Weak hits

Sequence:  465817.ETA_24530
Domain Number - Region: 5-77
Classification Level Classification E-value
Superfamily Rhomboid-like 0.00785
Family Rhomboid-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 465817.ETA_24530
Sequence length 150
Comment (Erwinia tasmaniensis)
Sequence
MLDALLANPWWLWLTLGGLLLAAEMLGASGYLLWSGVAAVLVSLLVWLVPLPWEWQGLSF
AALTILAALWWHRWLKSREQRQPPSTLNQRGQQLIGRQLTLDAALVNGFGHVRIGDGNWR
VQAEDDLPAGTRVVVVAVEGITLRVAVSRV
Download sequence
Identical sequences B2VBB6
WP_012442165.1.58220 gi|188534578|ref|YP_001908375.1| 465817.ETA_24530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]