SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 467705.SGO_0239 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  467705.SGO_0239
Domain Number 1 Region: 1-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.37e-29
Family GHMP Kinase, N-terminal domain 0.00086
Further Details:      
 
Domain Number 2 Region: 155-290
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 3.06e-27
Family Mevalonate kinase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 467705.SGO_0239
Sequence length 292
Comment (Streptococcus gordonii Challis substr CH1)
Sequence
MTKEIGVGKAHSKIILMGEHSVVYGYPAISLPLNHIEVTCRVFPSERPWTLYAEDTLSMA
VFACLEHLGRQGAKIRCQVESMVPEKRGMGSSAAVSIAAIRAVFDYFEEELDDQTLEILA
NRAEMIAHMNPSGLDAKTCLSDVAIKFIRNFGFSEIKLDLDAFLLIADTGIHGHTREAIR
AVESQGQKALPLLQELGNLTKILEKAISIKDLMTMGQAMTKAHEKLARLGVSCQKADELV
AVAIENGALGAKMSGGGLGGCVIALVGEKSQAEALAALLREKGAINTWIESL
Download sequence
Identical sequences A8AUU8
gi|157150364|ref|YP_001449558.1| 467705.SGO_0239 WP_011999770.1.24227 WP_011999770.1.30359 WP_011999770.1.30989 WP_011999770.1.42171 WP_011999770.1.45496 WP_011999770.1.50638 WP_011999770.1.73367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]