SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 469008.ECBD_3168 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  469008.ECBD_3168
Domain Number 1 Region: 95-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000942
Family NfeD domain-like 0.0079
Further Details:      
 
Weak hits

Sequence:  469008.ECBD_3168
Domain Number - Region: 33-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000497
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 469008.ECBD_3168
Sequence length 152
Comment (Escherichia coli BL21 DE3)
Sequence
MMELIVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLLPLGWEWQGVMF
AILTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLESPLVNGRGHMRVGDSS
WPVSASEDLGAGTHVEVIAIEGITLHIRAVSS
Download sequence
Identical sequences A0A140NC33 A0A142H035 A0A1V3W4T2 W1BG76
WP_000970309.1.12675 WP_000970309.1.13002 WP_000970309.1.17360 WP_000970309.1.18588 WP_000970309.1.20170 WP_000970309.1.21017 WP_000970309.1.24316 WP_000970309.1.25312 WP_000970309.1.27611 WP_000970309.1.31506 WP_000970309.1.35704 WP_000970309.1.36739 WP_000970309.1.38155 WP_000970309.1.39167 WP_000970309.1.41960 WP_000970309.1.46573 WP_000970309.1.47764 WP_000970309.1.48847 WP_000970309.1.51380 WP_000970309.1.51548 WP_000970309.1.52421 WP_000970309.1.54476 WP_000970309.1.56197 WP_000970309.1.56285 WP_000970309.1.59912 WP_000970309.1.66280 WP_000970309.1.67200 WP_000970309.1.6945 WP_000970309.1.71632 WP_000970309.1.76948 WP_000970309.1.78791 WP_000970309.1.79306 WP_000970309.1.81576 WP_000970309.1.8345 WP_000970309.1.84877 WP_000970309.1.88711 WP_000970309.1.89977 WP_000970309.1.93971 WP_000970309.1.96279 469008.ECBD_3168 gi|253774522|ref|YP_003037353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]