SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 469378.Ccur_03010 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  469378.Ccur_03010
Domain Number - Region: 38-88
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0131
Family NfeD domain-like 0.0081
Further Details:      
 
Domain Number - Region: 78-115
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 0.0628
Family Dihydropteroate synthetase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 469378.Ccur_03010
Sequence length 122
Comment (Cryptobacterium curtum DSM 15641)
Sequence
MRLAEKKQPIKAGLVRGRHELPVDTYIFDEIVDVFNFDGMYDKAAAFISDEVGVSRVAGR
AINAASYTDDEIYRGDSVLVVYVTGLTAALAAVIAACAAYGVPLVLMHYDRERGDYRPQT
IF
Download sequence
Identical sequences C7MM88
WP_012802716.1.80809 469378.Ccur_03010 gi|256826751|ref|YP_003150710.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]