SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 471223.GWCH70_0826 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471223.GWCH70_0826
Domain Number 1 Region: 116-363
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.97e-69
Family D-glucarate dehydratase-like 0.000000846
Further Details:      
 
Domain Number 2 Region: 3-128
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.31e-34
Family Enolase N-terminal domain-like 0.0000643
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 471223.GWCH70_0826
Sequence length 371
Comment (Geobacillus WCH70)
Sequence
MGIKVKRVILRHLQMELKSPFTTSFGSFQKKEFILVEAMDEDGLSGWGESVAFPSPWYNE
ETVKTNWHMIEDFLLPLLFQAPIAHPEELRQRFSVIRKNQMAKAAIEGAIWDLFAKRQQL
PLHKALGGNKNRIEVGVSIGIQKSIDDLLRIIERYVQEGYRRIKIKIKPGWDVEVVREVR
RRFPDVPLMVDANSAYSLEDIDRLKALDEFQLMMIEQPLAPDDIVDHATLQAQLNTPICL
DESIHSAEDARKAIQLGSCRIINIKIGRVGGLAEAKRIHDICKENDIPVWCGGMLEAGVG
RAHNIAITTLDNFTLPGDTAASSHYWTKDIIVPEVTVHHGTITVPEKPGIGYDVDRQQVD
IYTSYAKMYHA
Download sequence
Identical sequences A0A226QRN1 C5D7F0
WP_012749505.1.48526 WP_012749505.1.59651 471223.GWCH70_0826 gi|239826350|ref|YP_002948974.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]