SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 471821.TGRD_278 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471821.TGRD_278
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.19e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 471821.TGRD_278
Sequence length 188
Comment (uncultured Termite group 1 bacterium phylotype Rs D17)
Sequence
MIEVRWHGRGGQGAKTAALLFAEAVLATGKYIQAFPEYGPERMGAPVQSFNRISEAPITI
HSGITNPDYAVILDPSLIESVPVTDGIGEKGKVIVNTSFSSSEIAQKLGIDASQVFVVNA
SRIALETIGRNIPNTPMLGALVKVIGTLDINGVLEDTKVKLTAKFRHKPEVIEGNLASIK
CAFGEVKN
Download sequence
Identical sequences A0A1C9ZS73 B1GZS9
471821.TGRD_278 gi|189485281|ref|YP_001956222.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]