SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 471821.TGRD_442 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471821.TGRD_442
Domain Number 1 Region: 77-139
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000109
Family NfeD domain-like 0.0039
Further Details:      
 
Weak hits

Sequence:  471821.TGRD_442
Domain Number - Region: 9-62
Classification Level Classification E-value
Superfamily Clc chloride channel 0.0824
Family Clc chloride channel 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 471821.TGRD_442
Sequence length 139
Comment (uncultured Termite group 1 bacterium phylotype Rs D17)
Sequence
MIWITWLIIAAVLIIFEILTSSVFFFTCLATGSVFAAASAYFNFSSWVEFIIFIVVSILS
LYLIRPIFKRVMSKSETVNSNIDVLIGATAVVTEKITPLKTGLVKVSGEIWRAESDIELE
TGEIVKIKNIDGTTLTVRK
Download sequence
Identical sequences B1H093
471821.TGRD_442 gi|189485445|ref|YP_001956386.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]