SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 471852.Tcur_2633 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471852.Tcur_2633
Domain Number 1 Region: 96-346
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.76e-38
Family D-glucarate dehydratase-like 0.0000969
Further Details:      
 
Domain Number 2 Region: 9-108
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.7e-20
Family Enolase N-terminal domain-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 471852.Tcur_2633
Sequence length 351
Comment (Thermomonospora curvata DSM 43183)
Sequence
MPRIQDCQAFKVAMPRGRRPQSILVRLTNEDGTTGWGEVAFPEPPDSTWADISERLAPAL
LGLEWERPEDVSATVEFGTRPAAAAVDIACWDLWCRLKGLPLAHALGGTRTSIVTGTRID
TAPFLIDALISRVNQAVGSGHTRVTLKVRPGWDIEPVRAVRAAYPALAVVVDACGSYTES
EEHLETLQALDAYGLVAIERPFPAGDLAAHARLQQRLETAVCPQISDLDMLEAAIEQRAG
RMLHLDISLMGGLTAARGAHDRAYAAGWDVWCGGSGAFGIGQAAAVALAGLPGCTLPSDV
TDPAGGPAFVSPPVRSHGGVVGVPLTQPGLGHQVDEERIAKLATDTRRIPA
Download sequence
Identical sequences D1A518
471852.Tcur_2633 gi|269126855|ref|YP_003300225.1| WP_012852971.1.83154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]