SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 471853.Bcav_1487 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471853.Bcav_1487
Domain Number 1 Region: 141-412
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.75e-88
Family Enolase 0.000000645
Further Details:      
 
Domain Number 2 Region: 3-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.01e-32
Family Enolase N-terminal domain-like 0.0000873
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 471853.Bcav_1487
Sequence length 431
Comment (Beutenbergia cavernae DSM 12333)
Sequence
MTDMSIRTVTAWEALDSRGRPTVACRVDLADGARAVARVPSGASTGSHEAPELRDGGTRY
GGFGVRTAVAGLRDHLAPAVVGLPADETAAVDRALADAYARHGQQEVGANATLAVSLAAL
LAAAASRDEPLARMLHPEGPLPLPMPMVNIVSGGAHAAGAIDIQDVLVIPEGASTFAEAV
EWAARVRAAAAAVASGRGFAEAALVADEGGLGLRLGTNEAALQLVAEAVDAAGLGLGTDV
TIAIDAAATEFASDGRYALAAEDRALSAEEMVELYAEWVARYPIRSIEDPLAEDDWDGWA
LATRELGGRIDLVGDDLFVTQSDRLQRGIAEGCATSILVKVNQNGLVSRAGDVLRAARAA
GYRTVVSARSGETEDSWVADLAVGWSAGQLKVGSTQRSERTAKWNRVLELEATESTELQH
PWPSRTEETAS
Download sequence
Identical sequences C5C344
gi|229819979|ref|YP_002881505.1| 471853.Bcav_1487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]