SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 471853.Bcav_1685 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471853.Bcav_1685
Domain Number 1 Region: 133-389
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.36e-60
Family D-glucarate dehydratase-like 0.00029
Further Details:      
 
Domain Number 2 Region: 48-146
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.82e-22
Family Enolase N-terminal domain-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 471853.Bcav_1685
Sequence length 400
Comment (Beutenbergia cavernae DSM 12333)
Sequence
MRVTDVTCVEYVSHVEAPEPIFADRLRRPTDVYPEFRARGPQTFREVASGRYEIRSVFLH
VDTDTGLRGSTAQLSPEQAFIVSTVLRPLLLGADPLATERLWDVLYRSAIHGRAGAGMTA
LSAVDCALWDIRGQHLGVPAHVLLGGPTRSEIPAYASTLGDSLEPEHVAARTRELVAQGF
AGLKWFPRWGPEDGAAGVESVVELVGTVRDAAGDGVAIMLDAWSGWDVPFTLEVARATRD
QGVAWIEEPLLADQLEGYRTLRRRLPDGVRIAGGEHEYTRWGYRELLAADVLDLHQPDPH
WAGGISELTKIMALISAAGGQLVPHGQSLQCNAALSFAASPALVPQMEYLARLMPMYQHV
LREPVVPVGGVIAAPTAPGLGMTVDPAKVVSSRVIGGDAA
Download sequence
Identical sequences C5C428
WP_015882181.1.13559 471853.Bcav_1685 gi|229820177|ref|YP_002881703.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]