SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 471853.Bcav_2314 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471853.Bcav_2314
Domain Number 1 Region: 85-143
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000144
Family NfeD domain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 471853.Bcav_2314
Sequence length 181
Comment (Beutenbergia cavernae DSM 12333)
Sequence
MDNSGWIWWLGATLLLGVIEMLVVDLLFLMFAGGALAATIVAALGAPLWLQITTFGVVSA
LLVVAVRPWALRKFKNTTPETATNIAAHVGRPAVVVADVSTMAGRVKLAGEVWTARTEES
GVLPVGSLVRVIRIDGATAVVVREVPQQAGPGAAPGAPYGPPPTGPYHQPGPVPPPGSPT
T
Download sequence
Identical sequences C5BVW4
WP_015882805.1.13559 471853.Bcav_2314 gi|229820801|ref|YP_002882327.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]