SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 471853.Bcav_3392 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471853.Bcav_3392
Domain Number 1 Region: 98-362
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.23e-81
Family D-glucarate dehydratase-like 0.0000375
Further Details:      
 
Domain Number 2 Region: 1-114
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.05e-30
Family Enolase N-terminal domain-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 471853.Bcav_3392
Sequence length 398
Comment (Beutenbergia cavernae DSM 12333)
Sequence
MRLASLTTYLCDAYRTNWVFVRLETDDGLVGWGEATLEYREHTVEAALRALEPSLAGRDL
EDIQGWWQDAYRDAYWRGGAVLTSALSGIEMALWDLKGKLLGVPVHQLLGGTVRTEVECY
ANAWFAGARTAAEFAERARDAVEWGYRAVKWDPFGSAFRTVDRGELRSALAVVDAVAEAV
GDDAGLIVEAHGRFEVPTALRVARALEPFDLLWLEEPLIPGNTAALAEVRAATSTPIGVG
ERLYTRWDFREVFDARAADVVQPDVSHVGGIWEARTVASLAELWQVGFAPHNPSGPIANA
ATLQLAACVPNFTLLETMATDVPWRADVVVSEPSITHGRAPIPTAPGLGVELDAEALTRF
PYVRHDLRHYTGALTEIRPEDSVGRHEMPAPSLTGSPS
Download sequence
Identical sequences C5C209
471853.Bcav_3392 WP_015883871.1.13559 gi|229821870|ref|YP_002883396.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]