SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 471854.Dfer_1106 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471854.Dfer_1106
Domain Number 1 Region: 167-470
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.42e-64
Family D-glucarate dehydratase-like 0.00012
Further Details:      
 
Domain Number 2 Region: 79-184
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.34e-19
Family Enolase N-terminal domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 471854.Dfer_1106
Sequence length 494
Comment (Dyadobacter fermentans DSM 18053)
Sequence
MKNILKQIIDSNKQVETAEKAAAAAEIANPSTKDSRRNFLRKTAVGGIALGGFMSMSTED
TIAQATSKVSRASKPSELKITDLRYCIVQNVGRTPIIRIDTNQGIYGLGEVRDGADERYA
LFLKSHLLGQNPCNVEQLFKSIKQFGYHGRQAGGVCGVEMALWDLCGKAYGVPCWQLLGG
RYRDKVRLYADTPESNDINEFKQKIKFRTQDQGYTWLKMDISIGMLRNSEGGVVNNKFWG
GGFSQWAGDYHSYANTKHPFTAIQITPKGLDEMAKVVEDVRSVIGYEIPLSSDHYGHFDL
NNGIRLGKALDKYRLAWFEDMVPWEYTDQWKTISDALETPTLTGEDIYLKEGFKALIEQR
AVDIVHPDLASSGGLLETKRIGDYAEDHGIAMAMHFAGTPVSFMANVHCAAATQNFLALE
HHSVDVPWWESLVKTTDGRKLIDKGYAVVPLEAPGLGIELNEEEVKKHLHPKDKSFFAPT
PDWNDKRSHDRLWS
Download sequence
Identical sequences C6W4Z5
WP_015810609.1.10152 471854.Dfer_1106 gi|255034899|ref|YP_003085520.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]