SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 471854.Dfer_3005 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471854.Dfer_3005
Domain Number 1 Region: 77-142
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000432
Family NfeD domain-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 471854.Dfer_3005
Sequence length 144
Comment (Dyadobacter fermentans DSM 18053)
Sequence
MDLTLPQIWLIVGLVMLLAELVSVLLVFVFFAIGALLTSLLTSIGLLPTTESQILAFSAI
SLVSLLVLRKHARKLLERRSTAEYSEFTGETAMVIRDIPGNGEGRIYYRGAEWKAVSENH
ENISAGSKVVIKKTEGIILIVEES
Download sequence
Identical sequences C6W5K2
gi|255036764|ref|YP_003087385.1| WP_015812469.1.10152 471854.Dfer_3005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]