SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 471854.Dfer_3890 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471854.Dfer_3890
Domain Number 1 Region: 127-322
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.28e-53
Family D-glucarate dehydratase-like 0.00016
Further Details:      
 
Domain Number 2 Region: 2-118
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.6e-18
Family Enolase N-terminal domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 471854.Dfer_3890
Sequence length 342
Comment (Dyadobacter fermentans DSM 18053)
Sequence
MRLTFHTFDLQLKHTFTIAHDSRDVQQTLIVQLNDGTFAGFGEATSNPYYGVTIDNMIAA
LDRVKQIVEEGRYGSAEELWALAHPLLKDHPFAQCALDEAAQDYFAKKRGLKLYEAWGLS
PEHIPMTNFTIGIDTVEKMVAKMQELPWPIYKIKLGTDEDLRIVTELRKNTDALFRVDAN
CGWTAEKTIELAPQLAALGVEFIEQPLPADDIAGMKKVFEASALPVIADESCIIEADVAK
CQGLFHGINIKLTKCGGPTAALRMIAEARSLGMKTMVGCMTETSVGISAIAHLLPLLDYV
DMDGSLLIRNDPATGVTFDFGKVIYATGNGTGAALKPEFVSR
Download sequence
Identical sequences C6VXR1
gi|255037638|ref|YP_003088259.1| 471854.Dfer_3890 WP_015813338.1.10152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]