SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 471855.Shel_13460 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471855.Shel_13460
Domain Number 1 Region: 4-192
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.16e-37
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 471855.Shel_13460
Sequence length 196
Comment (Slackia heliotrinireducens DSM 20476)
Sequence
MADTKTILICGVGGQGALLAADLLARATAASGQQVKVSEIHGMAQRGGSVTTVVRIGDEV
KSMVADTGAVDYLISFETIEALRNISFLREGGTLIVADETIKSLPVAIGKAKMPARVHEQ
LNDAGALLVDAEELAFKAGSTKAVNVVLLGVLSYFLPYEVDTWNEVIAKRVPPKFKDINL
AAFAAGRAFAEEHVKA
Download sequence
Identical sequences C7N634
471855.Shel_13460 WP_012798471.1.33174 gi|257064046|ref|YP_003143718.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]