SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 471855.Shel_19670 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471855.Shel_19670
Domain Number 1 Region: 139-428
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.56e-131
Family Enolase 0.0000000135
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.92e-57
Family Enolase N-terminal domain-like 0.00000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 471855.Shel_19670
Sequence length 434
Comment (Slackia heliotrinireducens DSM 20476)
Sequence
MSIIIDVYGREVLDSRGNPTVEVEVALDDGCTGRAIVPSGASTGAFEAVELRDGDAERYL
GKGVTQAVEHVNNEIAEAIIGLDADDQRGLDEEMIDLDGTDNKGKLGANAILGASLAVAR
AAAESADLPLYKYIGGVNANMLPTPMMNILNGGVHADNNVDFQEFMIMPVGAGSFAEGLR
WCAEIYHTLKKVLHEAGLGGGVGDEGGFAPNLKTNEEPFVYITEACEKAGYKPGVDIMYA
MDPASTEFYDAERGMYVLAGEGVEYTSEQMVDYWAKLVEKWPIISIEDGMAEEDWDGWKL
LTDRIGDKVQLVGDDLFVTNPKRLKKGIELGVANAILVKVNQIGSLTESLDAIQMAKQAG
YACVISHRSGETEDTTIADLSVAVNAGQIKTGAPCRSDRIAKYNQLMRIEDELYTSSQYA
GWNAFYNIDTTTRG
Download sequence
Identical sequences C7N7U6
471855.Shel_19670 WP_012799083.1.33174 gi|257064658|ref|YP_003144330.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]