SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 471855.Shel_23560 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471855.Shel_23560
Domain Number 1 Region: 263-346
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000000017
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.004
Further Details:      
 
Domain Number 2 Region: 41-134
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.000000812
Family D-glucarate dehydratase-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 471855.Shel_23560
Sequence length 351
Comment (Slackia heliotrinireducens DSM 20476)
Sequence
MKPNESTRRVYVGGVPLGGGAPCVVQSMLNAPAMDVEANLAQINALAEAGCEVVRMAIPK
TECLDAFEEVCRKSPLPVVADIHFNANIAIEAARRGAAKLRINPGNIGGLEKTDAVIEAA
REAGIPIRIGVNAGSLDDELAARDDLTLPEKLAASAQQYVEYFLSRDFPDIVVSAKAHDV
MTTVETYRILSKTIPQVPLHIGITEAGTLMQGVVKSACGLGILLEEGIGDTMRISLTDEP
TAEIRACWMLLSALDLRRRGPEIISCPTCGRCQVDLIGIAKDVEEHLRTVKKPIKVAVMG
CVVNGPGEARDADIGVASGDGVGVVFKQGKVLRKVKEGDIVNTLMEEIENL
Download sequence
Identical sequences C7N1S4
WP_012799465.1.33174 471855.Shel_23560 gi|257065042|ref|YP_003144714.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]