SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 471856.Jden_1178 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471856.Jden_1178
Domain Number 1 Region: 76-140
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000902
Family NfeD domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 471856.Jden_1178
Sequence length 142
Comment (Jonesia denitrificans DSM 20603)
Sequence
MDWWIWLIVAIVLVVVEMLTLDLVLLMIAGGALAAALASGLGVDNLLVQGLIWAVVSLLL
LGTARRWMLERFRGRDTLSETNVHSYVGKAAQTLTDVTMTSGRVKFHGEVWSARTATGQV
PPHTTVTVVAIDGATAIVEPLA
Download sequence
Identical sequences C7R3X7
WP_015771462.1.34072 WP_015771462.1.39474 471856.Jden_1178 gi|256832410|ref|YP_003161137.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]