SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 471857.Svir_19790 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471857.Svir_19790
Domain Number 1 Region: 81-140
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000811
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 471857.Svir_19790
Sequence length 143
Comment (Saccharomonospora viridis DSM 43017)
Sequence
MTPAIIWLIVGVALIAAEVLSGDFVLVMLGLGALAGAGSTLISDNPIIHVIVFAVASTAL
IVLARPALKRHFLTGPNVRMNTEALLGTQAVTVSTVTSTGGQVKLAGEIWSARSIAEGEV
IEPDTTVTVVEISGATAVVSATP
Download sequence
Identical sequences A0A1I5KD84 C7MV45
gi|257055992|ref|YP_003133824.1| WP_015786310.1.37385 WP_015786310.1.67378 WP_015786310.1.81884 471857.Svir_19790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]