SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 476213.SPC_1405 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  476213.SPC_1405
Domain Number 1 Region: 106-304
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.69e-51
Family D-glucarate dehydratase-like 0.0000000151
Further Details:      
 
Domain Number 2 Region: 1-96
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.63e-27
Family Enolase N-terminal domain-like 0.00000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 476213.SPC_1405
Sequence length 320
Comment (Salmonella enterica serovar Paratyphi C RKS4594)
Sequence
MRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCLRDGEREGWGEISPLPGFSQETWEEAQ
TALLTWVNDWLQGSEGLPEMPSVAFGASCALAELTGVLPEAADYRAAPLCTGDPDDLVLR
LADMPGEKIAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKAQQFAKYVNP
DYRARIAFLEEPCKTRDDSRGFARETGIAIAWDESLREADFTFEAEEGVRAVVIKPTLTG
SLDKVREQVAAAHALGLTAVISSSIESSLGLTQLARIAAWLTPGTLPGLDTLHLMQAQQI
RPWPGSALPCLKREELERLL
Download sequence
Identical sequences C0Q062
WP_001255565.1.15637 gi|224583209|ref|YP_002637007.1| CP000857|CDS_1466346-1467308 476213.SPC_1405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]