SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 476213.SPC_3914 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  476213.SPC_3914
Domain Number 1 Region: 80-342
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.39e-71
Family D-glucarate dehydratase-like 0.00016
Further Details:      
 
Domain Number 2 Region: 2-97
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9e-30
Family Enolase N-terminal domain-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 476213.SPC_3914
Sequence length 367
Comment (Salmonella enterica serovar Paratyphi C RKS4594)
Sequence
MFLKIETDEGVVGWGEPVIEGRARTVEAAVHEFADYLIGKDPARINDLWQVMYRAGFYRG
GPIMMSAIAGIDQALWDIKGKVLNAPVWQLMGGLVRDKIKAYSWVGGDRPADVIDGIEKL
RGIGFDTFKLNGCEEMGVIDNSRAVDAAVNTVAQIREAFGSEIEFGLDFHGRVSAPMAKV
LIKELEPYRPLFIEEPVLAEQAEYYPRLAAQTHIPIAAGERMFSRFEFKRVLDAGGLAIL
QPDLSHAGGITECYKIAGMAEAYDVALAPHCPLGPIALAACLHIDFVSRNAVFQEQSMGI
HYNKGAELLDFVKNKEDFSMDGGFFKPLTKPGLGVDIDEARVIELSKSAPDWRNPLWRHA
DGSVAEW
Download sequence
Identical sequences C0Q2J8 G4C8E9 G5LBW3 G5LR96 G5NK23 G5QRZ3 G5SIR1 M7RGY8 S4HUD5 V7IQZ5
gi|224585626|ref|YP_002639425.1| CP000857|CDS_3967499-3966396 gi|383498456|ref|YP_005399145.1| 476213.SPC_3914 gi|528816762|ref|YP_008357965.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]