SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 477974.Daud_0133 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  477974.Daud_0133
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 2e-37
Family HEPN domain 0.000046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 477974.Daud_0133
Sequence length 129
Comment (Candidatus Desulforudis audaxviator MP104C)
Sequence
MVNRAMDWLTQGGYDLQHARNSLSMGDYEWASFAAHQAAEKAVKALVQHRGGEGWGHSVT
RLLLDLAALLSISDAVLLAAKRLDKHYIPARYPNGFDRGTPRDYYTEGEARQAISDAETV
YHFCRDAIC
Download sequence
Identical sequences B1I100
477974.Daud_0133 gi|169830351|ref|YP_001716333.1| WP_012301295.1.36146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]