SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 477974.Daud_0619 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  477974.Daud_0619
Domain Number 1 Region: 24-196
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.63e-25
Family Clp protease, ClpP subunit 0.025
Further Details:      
 
Domain Number 2 Region: 372-439
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000445
Family NfeD domain-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 477974.Daud_0619
Sequence length 443
Comment (Candidatus Desulforudis audaxviator MP104C)
Sequence
MGLERPRNRRIFAMCVLIFVGVALLVSAVPVQGRVADQVVVLRVDGPIVPVVAQYLDRGI
ADAERLGAVCVIELNTPGGLYDTTQKIVQRIMNADVPVVVFVSPAGGWAGSAGTFITISA
HVAAMAPGSRIGAAHPVAAGGEQMSGAQEEKITQDAAAWVRSIAEMRGRDAEKAELAVTE
SRSYTDNQALEFNLIDLRAPNLTELLTMIDGMTVALNSGEEVTLATANAPLERGEMNWVE
RILHTLSNPNIAYMLLSIGMLGLLLEFYNPGSIFPGVAGGLALILALYSLGTLDASWGGI
LLIILGFALFAFELFVPSFGLLTAGGLIAIVLGSMMLFAGSPAGFKVNIGVMAGVIVGIT
LFVVFAVRAVVKAHKRQASTGREGMSGAVGVTLTPLDPKGEILFDGERWRAVAEGGPIQA
DEEVVVVRMEDGLRLVVRRREKT
Download sequence
Identical sequences B1I2J2
477974.Daud_0619 gi|169830803|ref|YP_001716785.1| WP_012301741.1.36146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]