SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 478009.OE1711R from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  478009.OE1711R
Domain Number 1 Region: 198-464
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.8e-66
Family Pyruvate oxidase and decarboxylase Pyr module 0.081
Further Details:      
 
Domain Number 2 Region: 5-222
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.79e-37
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0074
Further Details:      
 
Domain Number 3 Region: 473-579
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000000445
Family Transketolase C-terminal domain-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 478009.OE1711R
Sequence length 582
Comment (Halobacterium salinarum R1)
Sequence
MHDDLNWAIGGEAGDGIASTGKIFAQALSRAGRHVFTSKDFASRIRGGYTAYKVRTSVDQ
VQSVVDRLDILIALTERTVDENLDELHADSIIIYDGDRTEFADFESPAEVTGLDIPLKDL
AEDAGGAIMRNIVALGAVCAVADFPIENLDESLEKRFSGKGEQIIENNKQAARLGAEYVA
EEFEDVTLPYELETTDEDYVLLNGDEAIGMGAIAAGCRFYAGYPITPATDVMEYLTGRIE
QFGGHVVQAEDELAAINLALGAARAGARSMTATSGPGIDLMSETFGLVATSETPLVIANV
MRSGPSTGMPTKQEQGDLNMMLKGGHGEIPRFVVAPTSVAECFHKTVEAFNLAEKYQLPV
YVTADLSMAVTERTYPPEEFDMDAVEIERGKLVDEDEISAWQNDTEQFRPHADTADGISP
RAVPGTEGGVHMSTGLEHDELGRRTEDTDVRVDQVDKRYRKVDTAREREQFDYREFGDSD
ADNLVVSWGSNEGTIVEALEYLDGDDDPDIRVVSVPYIYPRPDLTDEVEAADDVVVVEAN
ATGQFADVIEHDVLERVTRINNYTGVDFKADELAAEITESLA
Download sequence
Identical sequences B0R3G0 Q9HRZ5
gi|169235423|ref|YP_001688623.1| WP_010902308.1.1784 WP_010902308.1.50382 gi|15789709|ref|NP_279533.1| 478009.OE1711R 64091.VNG0474G APC66699.0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]