SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 478009.OE2558R from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  478009.OE2558R
Domain Number 1 Region: 107-324
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.36e-49
Family D-glucarate dehydratase-like 0.00062
Further Details:      
 
Domain Number 2 Region: 3-100
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 0.000000424
Family Enolase N-terminal domain-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 478009.OE2558R
Sequence length 331
Comment (Halobacterium salinarum R1)
Sequence
MIRAFSLALAEPLATANGTIGERTGFLFERDGGVGEATPLAGWTEPHDACMAALRAADDA
DSWERALDACMDAPAARHAVSLARMDADSCAAGRPLASALSDGAAADSVPVNATVGDGTA
AATSAAVADAAADGFDTVKVKVGSRSVRADLDRLRAASDTAPAGLSLRADANGAWDLDAA
RQAADACGSLPIEYIEQPLAPTRLDATRSIGGVPIALDEALHQHPLDAALAVADYVVLKP
MVLGGIDRARDAARTARQAGVEPVVSTTIDGVVARTAAVHLAASIPDVPACGLATADRLA
DALAPDPAPVAGGRIQVPADPGHGVEVTADA
Download sequence
Identical sequences B0R4T7
478009.OE2558R WP_012289275.1.1784 WP_012289275.1.50382 gi|169235900|ref|YP_001689100.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]