SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 478434.TBMG_02494 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  478434.TBMG_02494
Domain Number 1 Region: 77-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000105
Family NfeD domain-like 0.0058
Further Details:      
 
Weak hits

Sequence:  478434.TBMG_02494
Domain Number - Region: 10-71
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0235
Family LacY-like proton/sugar symporter 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 478434.TBMG_02494
Sequence length 144
Comment (Mycobacterium tuberculosis KZN 1435)
Sequence
MPVALIWLIAALVLVGAEALTGDMFLLMLGGGALAASVSSWLLAWPMWADGAVFLLVSVL
LLVLVRPAVRRRLTQTKGVQLGIEALEGKKAVVLGRVARDGGQVKLDGQVWTARPLNDGD
VFEPGDSVTVVQIDGATAVVFKDV
Download sequence
Identical sequences A0A045IYK6 A0A083WB45 A0A0H3LCW3 A0A0H3M660 A0A0K2HVA4 A0A109SND2 A0A120J0V8 A0A197IZT9 A0A1R3XYW5 A0A1S1BER7 A5U2J1 F8M7W4 G0TJ65 L0T700 L7N5G9 M8CFZ3 P71767 R4M1U0
gi|433634548|ref|YP_007268175.1| NP_216003.1.84033 WP_003407562.1.100000 WP_003407562.1.100021 WP_003407562.1.100069 WP_003407562.1.100087 WP_003407562.1.10015 WP_003407562.1.100208 WP_003407562.1.100216 WP_003407562.1.10022 WP_003407562.1.100255 WP_003407562.1.100260 WP_003407562.1.100270 WP_003407562.1.100279 WP_003407562.1.100286 WP_003407562.1.100308 WP_003407562.1.100309 WP_003407562.1.100318 WP_003407562.1.100337 WP_003407562.1.100338 WP_003407562.1.10037 WP_003407562.1.100383 WP_003407562.1.100395 WP_003407562.1.100396 WP_003407562.1.1004 WP_003407562.1.100401 WP_003407562.1.100459 WP_003407562.1.100460 WP_003407562.1.100552 WP_003407562.1.100581 WP_003407562.1.100600 WP_003407562.1.100625 WP_003407562.1.10064 WP_003407562.1.100666 WP_003407562.1.100671 WP_003407562.1.100677 WP_003407562.1.100682 WP_003407562.1.100697 WP_003407562.1.100703 WP_003407562.1.100716 WP_003407562.1.100722 WP_003407562.1.100754 WP_003407562.1.100757 WP_003407562.1.100772 WP_003407562.1.1008 WP_003407562.1.100812 WP_003407562.1.100845 WP_003407562.1.100866 WP_003407562.1.10088 WP_003407562.1.100889 WP_003407562.1.10090 WP_003407562.1.100910 WP_003407562.1.100915 WP_003407562.1.100935 WP_003407562.1.100984 WP_003407562.1.100992 WP_003407562.1.100998 WP_003407562.1.101 WP_003407562.1.101025 WP_003407562.1.101028 WP_003407562.1.10104 WP_003407562.1.101048 WP_003407562.1.101054 WP_003407562.1.101075 WP_003407562.1.101143 WP_003407562.1.101146 WP_003407562.1.10116 WP_003407562.1.10117 WP_003407562.1.101209 WP_003407562.1.10125 WP_003407562.1.101290 WP_003407562.1.101323 WP_003407562.1.101324 WP_003407562.1.101350 WP_003407562.1.101367 WP_003407562.1.101398 WP_003407562.1.101403 WP_003407562.1.101421 WP_003407562.1.10144 WP_003407562.1.101442 WP_003407562.1.10145 WP_003407562.1.101452 WP_003407562.1.101456 WP_003407562.1.101481 WP_003407562.1.101493 WP_003407562.1.101496 WP_003407562.1.101525 WP_003407562.1.101533 WP_003407562.1.101535 WP_003407562.1.101553 WP_003407562.1.101558 WP_003407562.1.10156 WP_003407562.1.101573 WP_003407562.1.101576 WP_003407562.1.10159 WP_003407562.1.101592 WP_003407562.1.101604 WP_003407562.1.101607 WP_003407562.1.101622 WP_003407562.1.101644 WP_003407562.1.101659 WP_003407562.1.101671 WP_003407562.1.101687 WP_003407562.1.101698 WP_003407562.1.10170 WP_003407562.1.101713 WP_003407562.1.101722 WP_003407562.1.101733 WP_003407562.1.101743 WP_003407562.1.101753 WP_003407562.1.101754 WP_003407562.1.101764 WP_003407562.1.101773 WP_003407562.1.101795 WP_003407562.1.101797 WP_003407562.1.101798 WP_003407562.1.101802 WP_003407562.1.101826 WP_003407562.1.101836 WP_003407562.1.101858 WP_003407562.1.101859 WP_003407562.1.101862 WP_003407562.1.101888 WP_003407562.1.101894 WP_003407562.1.101899 WP_003407562.1.1019 WP_003407562.1.101923 WP_003407562.1.101925 WP_003407562.1.10193 WP_003407562.1.101996 WP_003407562.1.102 WP_003407562.1.102008 WP_003407562.1.102017 WP_003407562.1.102053 WP_003407562.1.102055 WP_003407562.1.102063 WP_003407562.1.102099 WP_003407562.1.1021 WP_003407562.1.10211 WP_003407562.1.102119 WP_003407562.1.102121 WP_003407562.1.102143 WP_003407562.1.10216 WP_003407562.1.10224 WP_003407562.1.10253 WP_003407562.1.10262 WP_003407562.1.10272 WP_003407562.1.10277 WP_003407562.1.1033 WP_003407562.1.10350 WP_003407562.1.10362 WP_003407562.1.10366 WP_003407562.1.10376 WP_003407562.1.10396 WP_003407562.1.10410 WP_003407562.1.10414 WP_003407562.1.10421 WP_003407562.1.10430 WP_003407562.1.1044 WP_003407562.1.10440 WP_003407562.1.10445 WP_003407562.1.10471 WP_003407562.1.10472 WP_003407562.1.10489 WP_003407562.1.105 WP_003407562.1.10518 WP_003407562.1.10523 WP_003407562.1.10545 WP_003407562.1.1057 WP_003407562.1.10594 WP_003407562.1.10603 WP_003407562.1.10606 WP_003407562.1.10615 WP_003407562.1.10623 WP_003407562.1.10635 WP_003407562.1.10643 WP_003407562.1.10648 WP_003407562.1.10662 WP_003407562.1.10709 WP_003407562.1.10735 WP_003407562.1.10740 WP_003407562.1.10756 WP_003407562.1.1078 WP_003407562.1.10791 WP_003407562.1.10799 WP_003407562.1.10825 WP_003407562.1.10848 WP_003407562.1.10879 WP_003407562.1.10912 WP_003407562.1.10916 WP_003407562.1.10923 WP_003407562.1.10927 WP_003407562.1.1095 WP_003407562.1.10956 WP_003407562.1.10958 WP_003407562.1.10962 WP_003407562.1.10980 WP_003407562.1.10981 WP_003407562.1.10993 WP_003407562.1.1100 WP_003407562.1.11040 WP_003407562.1.11061 WP_003407562.1.11070 WP_003407562.1.11141 WP_003407562.1.11171 WP_003407562.1.11175 WP_003407562.1.11176 WP_003407562.1.11222 WP_003407562.1.11236 WP_003407562.1.11329 WP_003407562.1.1133 WP_003407562.1.11342 WP_003407562.1.11373 WP_003407562.1.11376 WP_003407562.1.11390 WP_003407562.1.11402 WP_003407562.1.11481 WP_003407562.1.11487 WP_003407562.1.11489 WP_003407562.1.11491 WP_003407562.1.11514 WP_003407562.1.11587 WP_003407562.1.11589 WP_003407562.1.11596 WP_003407562.1.11604 WP_003407562.1.11610 WP_003407562.1.11697 WP_003407562.1.11707 WP_003407562.1.11752 WP_003407562.1.11758 WP_003407562.1.11761 WP_003407562.1.11775 WP_003407562.1.11804 WP_003407562.1.11822 WP_003407562.1.11826 WP_003407562.1.11856 WP_003407562.1.11898 WP_003407562.1.11906 WP_003407562.1.11939 WP_003407562.1.11960 WP_003407562.1.11961 WP_003407562.1.11972 WP_003407562.1.11984 WP_003407562.1.120 WP_003407562.1.12001 WP_003407562.1.12049 WP_003407562.1.12052 WP_003407562.1.12100 WP_003407562.1.12116 WP_003407562.1.12130 WP_003407562.1.12133 WP_003407562.1.12161 WP_003407562.1.12165 WP_003407562.1.12184 WP_003407562.1.12187 WP_003407562.1.12190 WP_003407562.1.12216 WP_003407562.1.12265 WP_003407562.1.12275 WP_003407562.1.12293 WP_003407562.1.12294 WP_003407562.1.123 WP_003407562.1.1231 WP_003407562.1.12314 WP_003407562.1.12327 WP_003407562.1.12338 WP_003407562.1.1236 WP_003407562.1.12371 WP_003407562.1.12372 WP_003407562.1.12389 WP_003407562.1.12406 WP_003407562.1.1241 WP_003407562.1.12421 WP_003407562.1.12424 WP_003407562.1.12446 WP_003407562.1.12464 WP_003407562.1.12479 WP_003407562.1.12519 WP_003407562.1.12523 WP_003407562.1.12526 WP_003407562.1.1255 WP_003407562.1.12550 WP_003407562.1.12551 WP_003407562.1.12563 WP_003407562.1.12611 WP_003407562.1.12669 WP_003407562.1.1267 WP_003407562.1.12672 WP_003407562.1.12692 WP_003407562.1.1271 WP_003407562.1.12710 WP_003407562.1.12768 WP_003407562.1.1279 WP_003407562.1.12794 WP_003407562.1.12801 WP_003407562.1.12804 WP_003407562.1.12821 WP_003407562.1.12841 WP_003407562.1.12854 WP_003407562.1.12871 WP_003407562.1.12901 WP_003407562.1.12941 WP_003407562.1.12947 WP_003407562.1.12957 WP_003407562.1.12972 WP_003407562.1.13028 WP_003407562.1.13043 WP_003407562.1.13087 WP_003407562.1.13090 WP_003407562.1.13096 WP_003407562.1.13163 WP_003407562.1.13175 WP_003407562.1.13183 WP_003407562.1.132 WP_003407562.1.13249 WP_003407562.1.13284 WP_003407562.1.13296 WP_003407562.1.13298 WP_003407562.1.13302 WP_003407562.1.13306 WP_003407562.1.13312 WP_003407562.1.13313 WP_003407562.1.13321 WP_003407562.1.13345 WP_003407562.1.13358 WP_003407562.1.13370 WP_003407562.1.13375 WP_003407562.1.1338 WP_003407562.1.13420 WP_003407562.1.13433 WP_003407562.1.13435 WP_003407562.1.13438 WP_003407562.1.13461 WP_003407562.1.13466 WP_003407562.1.13489 WP_003407562.1.13526 WP_003407562.1.13551 WP_003407562.1.13561 WP_003407562.1.13564 WP_003407562.1.13579 WP_003407562.1.13647 WP_003407562.1.13667 WP_003407562.1.13687 WP_003407562.1.13697 WP_003407562.1.13719 WP_003407562.1.13763 WP_003407562.1.1377 WP_003407562.1.13774 WP_003407562.1.13786 WP_003407562.1.13793 WP_003407562.1.13794 WP_003407562.1.13817 WP_003407562.1.13834 WP_003407562.1.13866 WP_003407562.1.13880 WP_003407562.1.13899 WP_003407562.1.13909 WP_003407562.1.13910 WP_003407562.1.13919 WP_003407562.1.13920 WP_003407562.1.13952 WP_003407562.1.13953 WP_003407562.1.13962 WP_003407562.1.1398 WP_003407562.1.13988 WP_003407562.1.14027 WP_003407562.1.14046 WP_003407562.1.14115 WP_003407562.1.1415 WP_003407562.1.14152 WP_003407562.1.14158 WP_003407562.1.14162 WP_003407562.1.14175 WP_003407562.1.14178 WP_003407562.1.14194 WP_003407562.1.14195 WP_003407562.1.14208 WP_003407562.1.14238 WP_003407562.1.14266 WP_003407562.1.14273 WP_003407562.1.14303 WP_003407562.1.14306 WP_003407562.1.14307 WP_003407562.1.14310 WP_003407562.1.14341 WP_003407562.1.14382 WP_003407562.1.14416 WP_003407562.1.14428 WP_003407562.1.14441 WP_003407562.1.14469 WP_003407562.1.14477 WP_003407562.1.14504 WP_003407562.1.14514 WP_003407562.1.1452 WP_003407562.1.14527 WP_003407562.1.1454 WP_003407562.1.14544 WP_003407562.1.14548 WP_003407562.1.14551 WP_003407562.1.14561 WP_003407562.1.14573 WP_003407562.1.1462 WP_003407562.1.14658 WP_003407562.1.14667 WP_003407562.1.14668 WP_003407562.1.14675 WP_003407562.1.14694 WP_003407562.1.14695 WP_003407562.1.14709 WP_003407562.1.14766 WP_003407562.1.14783 WP_003407562.1.14865 WP_003407562.1.14872 WP_003407562.1.14905 WP_003407562.1.14926 WP_003407562.1.14951 WP_003407562.1.14955 WP_003407562.1.15003 WP_003407562.1.15009 WP_003407562.1.15028 WP_003407562.1.15040 WP_003407562.1.15052 WP_003407562.1.15065 WP_003407562.1.15072 WP_003407562.1.15089 WP_003407562.1.1509 WP_003407562.1.15126 WP_003407562.1.15131 WP_003407562.1.15168 WP_003407562.1.15172 WP_003407562.1.15174 WP_003407562.1.15187 WP_003407562.1.15196 WP_003407562.1.15210 WP_003407562.1.15216 WP_003407562.1.15217 WP_003407562.1.1523 WP_003407562.1.15232 WP_003407562.1.15238 WP_003407562.1.15240 WP_003407562.1.15253 WP_003407562.1.15267 WP_003407562.1.1527 WP_003407562.1.15292 WP_003407562.1.15299 WP_003407562.1.15302 WP_003407562.1.15322 WP_003407562.1.1534 WP_003407562.1.15345 WP_003407562.1.15365 WP_003407562.1.15372 WP_003407562.1.15386 WP_003407562.1.15387 WP_003407562.1.15442 WP_003407562.1.15447 WP_003407562.1.15449 WP_003407562.1.15477 WP_003407562.1.15481 WP_003407562.1.15492 WP_003407562.1.15511 WP_003407562.1.15512 WP_003407562.1.15558 WP_003407562.1.15559 WP_003407562.1.15566 WP_003407562.1.15599 WP_003407562.1.1560 WP_003407562.1.15611 WP_003407562.1.1563 WP_003407562.1.15633 WP_003407562.1.15643 WP_003407562.1.15688 WP_003407562.1.15755 WP_003407562.1.15763 WP_003407562.1.15774 WP_003407562.1.1578 WP_003407562.1.15780 WP_003407562.1.15827 WP_003407562.1.15834 WP_003407562.1.15842 WP_003407562.1.15848 WP_003407562.1.15853 WP_003407562.1.15870 WP_003407562.1.15877 WP_003407562.1.15893 WP_003407562.1.15896 WP_003407562.1.15926 WP_003407562.1.15933 WP_003407562.1.15946 WP_003407562.1.15958 WP_003407562.1.15973 WP_003407562.1.15987 WP_003407562.1.15993 WP_003407562.1.16009 WP_003407562.1.16025 WP_003407562.1.16043 WP_003407562.1.16055 WP_003407562.1.16066 WP_003407562.1.16069 WP_003407562.1.16077 WP_003407562.1.16106 WP_003407562.1.16108 WP_003407562.1.16110 WP_003407562.1.16130 WP_003407562.1.16136 WP_003407562.1.16139 WP_003407562.1.16141 WP_003407562.1.16143 WP_003407562.1.1630 WP_003407562.1.16318 WP_003407562.1.1632 WP_003407562.1.16327 WP_003407562.1.16334 WP_003407562.1.16341 WP_003407562.1.16345 WP_003407562.1.16374 WP_003407562.1.16384 WP_003407562.1.16386 WP_003407562.1.164 WP_003407562.1.1642 WP_003407562.1.16421 WP_003407562.1.16424 WP_003407562.1.16426 WP_003407562.1.16431 WP_003407562.1.1644 WP_003407562.1.16442 WP_003407562.1.16448 WP_003407562.1.16451 WP_003407562.1.16476 WP_003407562.1.16480 WP_003407562.1.16494 WP_003407562.1.1652 WP_003407562.1.16549 WP_003407562.1.16560 WP_003407562.1.16598 WP_003407562.1.16609 WP_003407562.1.16619 WP_003407562.1.16620 WP_003407562.1.16622 WP_003407562.1.16637 WP_003407562.1.1669 WP_003407562.1.16707 WP_003407562.1.16724 WP_003407562.1.16731 WP_003407562.1.16743 WP_003407562.1.1683 WP_003407562.1.16837 WP_003407562.1.16852 WP_003407562.1.16937 WP_003407562.1.16940 WP_003407562.1.16950 WP_003407562.1.16959 WP_003407562.1.16968 WP_003407562.1.1697 WP_003407562.1.16973 WP_003407562.1.16977 WP_003407562.1.16987 WP_003407562.1.17005 WP_003407562.1.17006 WP_003407562.1.17010 WP_003407562.1.17015 WP_003407562.1.17019 WP_003407562.1.17039 WP_003407562.1.17041 WP_003407562.1.17052 WP_003407562.1.17057 WP_003407562.1.17062 WP_003407562.1.1707 WP_003407562.1.17094 WP_003407562.1.17130 WP_003407562.1.17138 WP_003407562.1.17147 WP_003407562.1.17167 WP_003407562.1.17224 WP_003407562.1.17251 WP_003407562.1.17288 WP_003407562.1.17304 WP_003407562.1.17314 WP_003407562.1.17345 WP_003407562.1.17381 WP_003407562.1.17391 WP_003407562.1.17412 WP_003407562.1.1743 WP_003407562.1.17440 WP_003407562.1.17466 WP_003407562.1.17477 WP_003407562.1.17483 WP_003407562.1.17505 WP_003407562.1.17527 WP_003407562.1.17540 WP_003407562.1.17553 WP_003407562.1.17558 WP_003407562.1.17599 WP_003407562.1.17635 WP_003407562.1.17655 WP_003407562.1.17679 WP_003407562.1.1768 WP_003407562.1.17687 WP_003407562.1.17700 WP_003407562.1.17710 WP_003407562.1.17713 WP_003407562.1.17722 WP_003407562.1.17746 WP_003407562.1.17788 WP_003407562.1.17798 WP_003407562.1.17803 WP_003407562.1.17816 WP_003407562.1.17821 WP_003407562.1.17830 WP_003407562.1.17868 WP_003407562.1.17878 WP_003407562.1.1792 WP_003407562.1.17923 WP_003407562.1.1795 WP_003407562.1.17955 WP_003407562.1.17973 WP_003407562.1.18009 WP_003407562.1.18013 WP_003407562.1.18033 WP_003407562.1.18057 WP_003407562.1.18070 WP_003407562.1.18116 WP_003407562.1.18120 WP_003407562.1.18126 WP_003407562.1.1817 WP_003407562.1.18170 WP_003407562.1.18206 WP_003407562.1.18216 WP_003407562.1.18240 WP_003407562.1.18257 WP_003407562.1.18297 WP_003407562.1.18306 WP_003407562.1.18364 WP_003407562.1.18399 WP_003407562.1.18411 WP_003407562.1.18444 WP_003407562.1.18448 WP_003407562.1.18467 WP_003407562.1.18476 WP_003407562.1.18522 WP_003407562.1.18580 WP_003407562.1.18582 WP_003407562.1.18587 WP_003407562.1.186 WP_003407562.1.18601 WP_003407562.1.18639 WP_003407562.1.18646 WP_003407562.1.18647 WP_003407562.1.1868 WP_003407562.1.18694 WP_003407562.1.18710 WP_003407562.1.18751 WP_003407562.1.18781 WP_003407562.1.18793 WP_003407562.1.18804 WP_003407562.1.18816 WP_003407562.1.18823 WP_003407562.1.18827 WP_003407562.1.18838 WP_003407562.1.18849 WP_003407562.1.18856 WP_003407562.1.18945 WP_003407562.1.1898 WP_003407562.1.19005 WP_003407562.1.19056 WP_003407562.1.19063 WP_003407562.1.19066 WP_003407562.1.19071 WP_003407562.1.19085 WP_003407562.1.19094 WP_003407562.1.19144 WP_003407562.1.19159 WP_003407562.1.19193 WP_003407562.1.19231 WP_003407562.1.19243 WP_003407562.1.19264 WP_003407562.1.19295 WP_003407562.1.19307 WP_003407562.1.19326 WP_003407562.1.1933 WP_003407562.1.19364 WP_003407562.1.19382 WP_003407562.1.19400 WP_003407562.1.19426 WP_003407562.1.19429 WP_003407562.1.19464 WP_003407562.1.19480 WP_003407562.1.19512 WP_003407562.1.19553 WP_003407562.1.19562 WP_003407562.1.19564 WP_003407562.1.19568 WP_003407562.1.19572 WP_003407562.1.19596 WP_003407562.1.19600 WP_003407562.1.19630 WP_003407562.1.19694 WP_003407562.1.1970 WP_003407562.1.19707 WP_003407562.1.19742 WP_003407562.1.19785 WP_003407562.1.19820 WP_003407562.1.19868 WP_003407562.1.19874 WP_003407562.1.19890 WP_003407562.1.19900 WP_003407562.1.19922 WP_003407562.1.19936 WP_003407562.1.19946 WP_003407562.1.19949 WP_003407562.1.19960 WP_003407562.1.19964 WP_003407562.1.20007 WP_003407562.1.20016 WP_003407562.1.20028 WP_003407562.1.2003 WP_003407562.1.20037 WP_003407562.1.20039 WP_003407562.1.20082 WP_003407562.1.20085 WP_003407562.1.20097 WP_003407562.1.20116 WP_003407562.1.20130 WP_003407562.1.20140 WP_003407562.1.20141 WP_003407562.1.20142 WP_003407562.1.20158 WP_003407562.1.20239 WP_003407562.1.20243 WP_003407562.1.20259 WP_003407562.1.20262 WP_003407562.1.20268 WP_003407562.1.20272 WP_003407562.1.20273 WP_003407562.1.20280 WP_003407562.1.20294 WP_003407562.1.20300 WP_003407562.1.20309 WP_003407562.1.20322 WP_003407562.1.2037 WP_003407562.1.20372 WP_003407562.1.20381 WP_003407562.1.204 WP_003407562.1.20427 WP_003407562.1.20432 WP_003407562.1.20457 WP_003407562.1.20459 WP_003407562.1.20460 WP_003407562.1.20542 WP_003407562.1.20578 WP_003407562.1.20608 WP_003407562.1.20624 WP_003407562.1.20628 WP_003407562.1.2066 WP_003407562.1.20707 WP_003407562.1.20722 WP_003407562.1.20729 WP_003407562.1.20742 WP_003407562.1.20751 WP_003407562.1.20843 WP_003407562.1.20850 WP_003407562.1.2086 WP_003407562.1.20868 WP_003407562.1.20876 WP_003407562.1.20897 WP_003407562.1.20898 WP_003407562.1.2090 WP_003407562.1.20911 WP_003407562.1.20916 WP_003407562.1.20921 WP_003407562.1.20927 WP_003407562.1.20951 WP_003407562.1.20970 WP_003407562.1.21070 WP_003407562.1.21127 WP_003407562.1.21135 WP_003407562.1.21173 WP_003407562.1.21187 WP_003407562.1.212 WP_003407562.1.2120 WP_003407562.1.21218 WP_003407562.1.21219 WP_003407562.1.2123 WP_003407562.1.21231 WP_003407562.1.21234 WP_003407562.1.2126 WP_003407562.1.21292 WP_003407562.1.21307 WP_003407562.1.2131 WP_003407562.1.21311 WP_003407562.1.21321 WP_003407562.1.21365 WP_003407562.1.2137 WP_003407562.1.21392 WP_003407562.1.21397 WP_003407562.1.21403 WP_003407562.1.21415 WP_003407562.1.21418 WP_003407562.1.21430 WP_003407562.1.21434 WP_003407562.1.21444 WP_003407562.1.21468 WP_003407562.1.21498 WP_003407562.1.21509 WP_003407562.1.21513 WP_003407562.1.21560 WP_003407562.1.21565 WP_003407562.1.21586 WP_003407562.1.21591 WP_003407562.1.21594 WP_003407562.1.21602 WP_003407562.1.21615 WP_003407562.1.21638 WP_003407562.1.21639 WP_003407562.1.21655 WP_003407562.1.21658 WP_003407562.1.2168 WP_003407562.1.2174 WP_003407562.1.21741 WP_003407562.1.21742 WP_003407562.1.21777 WP_003407562.1.21786 WP_003407562.1.21795 WP_003407562.1.218 WP_003407562.1.21826 WP_003407562.1.21829 WP_003407562.1.21840 WP_003407562.1.21843 WP_003407562.1.21872 WP_003407562.1.21873 WP_003407562.1.2188 WP_003407562.1.21882 WP_003407562.1.21906 WP_003407562.1.21912 WP_003407562.1.2194 WP_003407562.1.21941 WP_003407562.1.21956 WP_003407562.1.21958 WP_003407562.1.21960 WP_003407562.1.21971 WP_003407562.1.21973 WP_003407562.1.21983 WP_003407562.1.22003 WP_003407562.1.22013 WP_003407562.1.22025 WP_003407562.1.22036 WP_003407562.1.22075 WP_003407562.1.22092 WP_003407562.1.2212 WP_003407562.1.22127 WP_003407562.1.22140 WP_003407562.1.22233 WP_003407562.1.22255 WP_003407562.1.22277 WP_003407562.1.22305 WP_003407562.1.22348 WP_003407562.1.22356 WP_003407562.1.22366 WP_003407562.1.2238 WP_003407562.1.22380 WP_003407562.1.22437 WP_003407562.1.22438 WP_003407562.1.22445 WP_003407562.1.22490 WP_003407562.1.22511 WP_003407562.1.22524 WP_003407562.1.2253 WP_003407562.1.22585 WP_003407562.1.22589 WP_003407562.1.22606 WP_003407562.1.22608 WP_003407562.1.22609 WP_003407562.1.22618 WP_003407562.1.2262 WP_003407562.1.22624 WP_003407562.1.22629 WP_003407562.1.22664 WP_003407562.1.22665 WP_003407562.1.22670 WP_003407562.1.22674 WP_003407562.1.22680 WP_003407562.1.22725 WP_003407562.1.22728 WP_003407562.1.22733 WP_003407562.1.22737 WP_003407562.1.2275 WP_003407562.1.22754 WP_003407562.1.22797 WP_003407562.1.22800 WP_003407562.1.22804 WP_003407562.1.22829 WP_003407562.1.22840 WP_003407562.1.22844 WP_003407562.1.22963 WP_003407562.1.22970 WP_003407562.1.22996 WP_003407562.1.22997 WP_003407562.1.22999 WP_003407562.1.23015 WP_003407562.1.23032 WP_003407562.1.231 WP_003407562.1.23101 WP_003407562.1.2312 WP_003407562.1.23140 WP_003407562.1.23153 WP_003407562.1.23171 WP_003407562.1.23199 WP_003407562.1.2320 WP_003407562.1.23204 WP_003407562.1.23216 WP_003407562.1.23229 WP_003407562.1.23233 WP_003407562.1.2326 WP_003407562.1.23261 WP_003407562.1.23272 WP_003407562.1.23289 WP_003407562.1.2329 WP_003407562.1.23308 WP_003407562.1.23316 WP_003407562.1.23321 WP_003407562.1.23325 WP_003407562.1.2339 WP_003407562.1.23406 WP_003407562.1.23438 WP_003407562.1.23445 WP_003407562.1.23447 WP_003407562.1.23452 WP_003407562.1.23461 WP_003407562.1.2349 WP_003407562.1.23496 WP_003407562.1.23497 WP_003407562.1.23506 WP_003407562.1.23530 WP_003407562.1.23539 WP_003407562.1.23546 WP_003407562.1.23551 WP_003407562.1.23573 WP_003407562.1.23583 WP_003407562.1.23588 WP_003407562.1.23628 WP_003407562.1.23677 WP_003407562.1.23683 WP_003407562.1.23692 WP_003407562.1.23694 WP_003407562.1.23699 WP_003407562.1.2371 WP_003407562.1.23807 WP_003407562.1.23825 WP_003407562.1.23832 WP_003407562.1.2384 WP_003407562.1.23843 WP_003407562.1.23863 WP_003407562.1.2387 WP_003407562.1.23894 WP_003407562.1.23993 WP_003407562.1.2400 WP_003407562.1.24007 WP_003407562.1.24008 WP_003407562.1.24046 WP_003407562.1.24057 WP_003407562.1.24062 WP_003407562.1.24113 WP_003407562.1.24119 WP_003407562.1.24128 WP_003407562.1.24140 WP_003407562.1.24176 WP_003407562.1.24190 WP_003407562.1.24202 WP_003407562.1.24244 WP_003407562.1.24261 WP_003407562.1.24284 WP_003407562.1.24294 WP_003407562.1.24357 WP_003407562.1.24396 WP_003407562.1.24414 WP_003407562.1.24423 WP_003407562.1.2443 WP_003407562.1.24446 WP_003407562.1.24461 WP_003407562.1.24500 WP_003407562.1.24507 WP_003407562.1.24509 WP_003407562.1.24529 WP_003407562.1.24553 WP_003407562.1.24599 WP_003407562.1.24629 WP_003407562.1.24638 WP_003407562.1.24648 WP_003407562.1.2466 WP_003407562.1.24767 WP_003407562.1.24824 WP_003407562.1.24831 WP_003407562.1.24840 WP_003407562.1.24848 WP_003407562.1.24857 WP_003407562.1.2487 WP_003407562.1.24893 WP_003407562.1.24907 WP_003407562.1.24933 WP_003407562.1.24956 WP_003407562.1.24958 WP_003407562.1.24985 WP_003407562.1.2499 WP_003407562.1.25004 WP_003407562.1.2505 WP_003407562.1.25051 WP_003407562.1.2507 WP_003407562.1.25103 WP_003407562.1.25129 WP_003407562.1.25171 WP_003407562.1.25184 WP_003407562.1.25247 WP_003407562.1.25252 WP_003407562.1.25278 WP_003407562.1.25283 WP_003407562.1.25309 WP_003407562.1.25313 WP_003407562.1.25338 WP_003407562.1.25342 WP_003407562.1.25343 WP_003407562.1.25367 WP_003407562.1.25393 WP_003407562.1.25406 WP_003407562.1.25435 WP_003407562.1.25437 WP_003407562.1.25445 WP_003407562.1.25455 WP_003407562.1.25473 WP_003407562.1.25504 WP_003407562.1.25513 WP_003407562.1.25542 WP_003407562.1.25579 WP_003407562.1.25594 WP_003407562.1.25606 WP_003407562.1.25645 WP_003407562.1.2566 WP_003407562.1.25673 WP_003407562.1.25693 WP_003407562.1.25699 WP_003407562.1.25727 WP_003407562.1.25736 WP_003407562.1.25738 WP_003407562.1.25756 WP_003407562.1.25759 WP_003407562.1.2580 WP_003407562.1.25813 WP_003407562.1.25853 WP_003407562.1.25854 WP_003407562.1.25874 WP_003407562.1.25885 WP_003407562.1.25892 WP_003407562.1.25906 WP_003407562.1.25914 WP_003407562.1.25916 WP_003407562.1.2594 WP_003407562.1.25954 WP_003407562.1.25965 WP_003407562.1.25972 WP_003407562.1.26017 WP_003407562.1.26032 WP_003407562.1.26038 WP_003407562.1.26072 WP_003407562.1.26089 WP_003407562.1.26097 WP_003407562.1.26098 WP_003407562.1.26108 WP_003407562.1.26109 WP_003407562.1.26118 WP_003407562.1.26126 WP_003407562.1.2614 WP_003407562.1.26168 WP_003407562.1.26182 WP_003407562.1.26190 WP_003407562.1.2620 WP_003407562.1.26234 WP_003407562.1.26243 WP_003407562.1.26265 WP_003407562.1.26267 WP_003407562.1.26292 WP_003407562.1.26310 WP_003407562.1.26328 WP_003407562.1.26349 WP_003407562.1.26366 WP_003407562.1.26374 WP_003407562.1.26407 WP_003407562.1.26412 WP_003407562.1.26454 WP_003407562.1.26464 WP_003407562.1.2653 WP_003407562.1.26560 WP_003407562.1.26571 WP_003407562.1.2659 WP_003407562.1.26597 WP_003407562.1.26603 WP_003407562.1.26629 WP_003407562.1.26651 WP_003407562.1.26702 WP_003407562.1.26707 WP_003407562.1.26710 WP_003407562.1.26719 WP_003407562.1.26737 WP_003407562.1.26738 WP_003407562.1.26745 WP_003407562.1.26756 WP_003407562.1.2676 WP_003407562.1.2677 WP_003407562.1.26779 WP_003407562.1.26780 WP_003407562.1.26798 WP_003407562.1.26854 WP_003407562.1.26868 WP_003407562.1.26876 WP_003407562.1.26888 WP_003407562.1.26914 WP_003407562.1.26945 WP_003407562.1.26959 WP_003407562.1.26969 WP_003407562.1.26984 WP_003407562.1.26992 WP_003407562.1.27004 WP_003407562.1.27017 WP_003407562.1.27045 WP_003407562.1.27074 WP_003407562.1.27075 WP_003407562.1.27128 WP_003407562.1.27130 WP_003407562.1.27139 WP_003407562.1.27152 WP_003407562.1.27162 WP_003407562.1.27164 WP_003407562.1.27193 WP_003407562.1.27235 WP_003407562.1.27254 WP_003407562.1.27278 WP_003407562.1.27343 WP_003407562.1.27352 WP_003407562.1.27369 WP_003407562.1.27391 WP_003407562.1.27398 WP_003407562.1.27402 WP_003407562.1.27410 WP_003407562.1.27411 WP_003407562.1.27449 WP_003407562.1.27460 WP_003407562.1.27463 WP_003407562.1.2749 WP_003407562.1.27492 WP_003407562.1.27528 WP_003407562.1.27541 WP_003407562.1.27576 WP_003407562.1.27582 WP_003407562.1.27596 WP_003407562.1.27607 WP_003407562.1.2766 WP_003407562.1.277 WP_003407562.1.27730 WP_003407562.1.27736 WP_003407562.1.27743 WP_003407562.1.27750 WP_003407562.1.27771 WP_003407562.1.27779 WP_003407562.1.27795 WP_003407562.1.27803 WP_003407562.1.27819 WP_003407562.1.27835 WP_003407562.1.27915 WP_003407562.1.27935 WP_003407562.1.27962 WP_003407562.1.28053 WP_003407562.1.28092 WP_003407562.1.28106 WP_003407562.1.28131 WP_003407562.1.28142 WP_003407562.1.28159 WP_003407562.1.2816 WP_003407562.1.28161 WP_003407562.1.28192 WP_003407562.1.28202 WP_003407562.1.28241 WP_003407562.1.28242 WP_003407562.1.28251 WP_003407562.1.28269 WP_003407562.1.28276 WP_003407562.1.28293 WP_003407562.1.28331 WP_003407562.1.28367 WP_003407562.1.28378 WP_003407562.1.28391 WP_003407562.1.2842 WP_003407562.1.28448 WP_003407562.1.2847 WP_003407562.1.28471 WP_003407562.1.28473 WP_003407562.1.28493 WP_003407562.1.28497 WP_003407562.1.28530 WP_003407562.1.28545 WP_003407562.1.28561 WP_003407562.1.28567 WP_003407562.1.28585 WP_003407562.1.286 WP_003407562.1.28610 WP_003407562.1.28617 WP_003407562.1.28634 WP_003407562.1.28642 WP_003407562.1.28671 WP_003407562.1.28682 WP_003407562.1.28698 WP_003407562.1.28703 WP_003407562.1.28739 WP_003407562.1.28758 WP_003407562.1.28781 WP_003407562.1.28787 WP_003407562.1.28827 WP_003407562.1.28839 WP_003407562.1.28847 WP_003407562.1.28850 WP_003407562.1.28851 WP_003407562.1.28865 WP_003407562.1.28897 WP_003407562.1.28914 WP_003407562.1.28935 WP_003407562.1.28936 WP_003407562.1.28939 WP_003407562.1.28943 WP_003407562.1.28952 WP_003407562.1.28975 WP_003407562.1.2899 WP_003407562.1.28993 WP_003407562.1.29000 WP_003407562.1.2901 WP_003407562.1.29028 WP_003407562.1.29033 WP_003407562.1.29058 WP_003407562.1.29078 WP_003407562.1.29102 WP_003407562.1.29115 WP_003407562.1.2916 WP_003407562.1.29217 WP_003407562.1.29223 WP_003407562.1.29234 WP_003407562.1.29264 WP_003407562.1.29275 WP_003407562.1.29306 WP_003407562.1.29339 WP_003407562.1.29348 WP_003407562.1.29364 WP_003407562.1.29367 WP_003407562.1.29399 WP_003407562.1.29426 WP_003407562.1.2944 WP_003407562.1.29449 WP_003407562.1.29450 WP_003407562.1.29452 WP_003407562.1.2949 WP_003407562.1.29510 WP_003407562.1.29515 WP_003407562.1.29525 WP_003407562.1.2953 WP_003407562.1.29559 WP_003407562.1.29587 WP_003407562.1.2959 WP_003407562.1.29592 WP_003407562.1.29599 WP_003407562.1.29611 WP_003407562.1.29632 WP_003407562.1.29649 WP_003407562.1.2965 WP_003407562.1.29659 WP_003407562.1.2969 WP_003407562.1.29696 WP_003407562.1.29698 WP_003407562.1.29718 WP_003407562.1.29742 WP_003407562.1.29745 WP_003407562.1.29747 WP_003407562.1.29769 WP_003407562.1.29825 WP_003407562.1.29830 WP_003407562.1.29847 WP_003407562.1.29861 WP_003407562.1.29869 WP_003407562.1.29883 WP_003407562.1.29890 WP_003407562.1.299 WP_003407562.1.29931 WP_003407562.1.29960 WP_003407562.1.30014 WP_003407562.1.3004 WP_003407562.1.30040 WP_003407562.1.30074 WP_003407562.1.30097 WP_003407562.1.30101 WP_003407562.1.30106 WP_003407562.1.30114 WP_003407562.1.30126 WP_003407562.1.30131 WP_003407562.1.30138 WP_003407562.1.30139 WP_003407562.1.30211 WP_003407562.1.30224 WP_003407562.1.30235 WP_003407562.1.30237 WP_003407562.1.3027 WP_003407562.1.30279 WP_003407562.1.30282 WP_003407562.1.30283 WP_003407562.1.30288 WP_003407562.1.30291 WP_003407562.1.30363 WP_003407562.1.30374 WP_003407562.1.30404 WP_003407562.1.3043 WP_003407562.1.30433 WP_003407562.1.30438 WP_003407562.1.30462 WP_003407562.1.30464 WP_003407562.1.30468 WP_003407562.1.30500 WP_003407562.1.3057 WP_003407562.1.30574 WP_003407562.1.30628 WP_003407562.1.30641 WP_003407562.1.30642 WP_003407562.1.30661 WP_003407562.1.30669 WP_003407562.1.30683 WP_003407562.1.30699 WP_003407562.1.30709 WP_003407562.1.30713 WP_003407562.1.30716 WP_003407562.1.30719 WP_003407562.1.30730 WP_003407562.1.30732 WP_003407562.1.30736 WP_003407562.1.30745 WP_003407562.1.30760 WP_003407562.1.30791 WP_003407562.1.308 WP_003407562.1.30807 WP_003407562.1.30818 WP_003407562.1.30848 WP_003407562.1.30877 WP_003407562.1.30888 WP_003407562.1.30901 WP_003407562.1.30903 WP_003407562.1.30912 WP_003407562.1.30913 WP_003407562.1.30914 WP_003407562.1.30919 WP_003407562.1.30977 WP_003407562.1.3100 WP_003407562.1.31002 WP_003407562.1.3101 WP_003407562.1.31034 WP_003407562.1.31047 WP_003407562.1.31070 WP_003407562.1.31074 WP_003407562.1.31102 WP_003407562.1.31127 WP_003407562.1.31184 WP_003407562.1.31199 WP_003407562.1.31226 WP_003407562.1.31230 WP_003407562.1.31233 WP_003407562.1.31263 WP_003407562.1.31264 WP_003407562.1.31270 WP_003407562.1.31287 WP_003407562.1.31290 WP_003407562.1.31304 WP_003407562.1.31346 WP_003407562.1.31348 WP_003407562.1.31354 WP_003407562.1.31390 WP_003407562.1.31414 WP_003407562.1.31417 WP_003407562.1.31428 WP_003407562.1.3143 WP_003407562.1.31483 WP_003407562.1.3149 WP_003407562.1.31498 WP_003407562.1.31507 WP_003407562.1.31537 WP_003407562.1.31548 WP_003407562.1.31569 WP_003407562.1.31573 WP_003407562.1.316 WP_003407562.1.31629 WP_003407562.1.31666 WP_003407562.1.31693 WP_003407562.1.31703 WP_003407562.1.31744 WP_003407562.1.31745 WP_003407562.1.31770 WP_003407562.1.31776 WP_003407562.1.31783 WP_003407562.1.318 WP_003407562.1.3184 WP_003407562.1.31840 WP_003407562.1.31880 WP_003407562.1.31911 WP_003407562.1.31930 WP_003407562.1.31932 WP_003407562.1.31955 WP_003407562.1.31985 WP_003407562.1.31991 WP_003407562.1.31995 WP_003407562.1.32004 WP_003407562.1.32039 WP_003407562.1.3204 WP_003407562.1.32045 WP_003407562.1.32071 WP_003407562.1.32098 WP_003407562.1.32132 WP_003407562.1.32157 WP_003407562.1.32164 WP_003407562.1.32179 WP_003407562.1.32198 WP_003407562.1.32297 WP_003407562.1.32317 WP_003407562.1.32383 WP_003407562.1.32400 WP_003407562.1.32403 WP_003407562.1.32416 WP_003407562.1.32421 WP_003407562.1.32433 WP_003407562.1.32461 WP_003407562.1.32482 WP_003407562.1.32503 WP_003407562.1.32556 WP_003407562.1.32562 WP_003407562.1.32569 WP_003407562.1.32592 WP_003407562.1.32620 WP_003407562.1.32647 WP_003407562.1.32653 WP_003407562.1.32654 WP_003407562.1.3268 WP_003407562.1.32695 WP_003407562.1.32706 WP_003407562.1.32716 WP_003407562.1.32738 WP_003407562.1.32752 WP_003407562.1.32780 WP_003407562.1.32781 WP_003407562.1.32793 WP_003407562.1.32799 WP_003407562.1.32822 WP_003407562.1.32833 WP_003407562.1.32862 WP_003407562.1.32880 WP_003407562.1.32897 WP_003407562.1.32909 WP_003407562.1.32935 WP_003407562.1.32974 WP_003407562.1.33007 WP_003407562.1.3302 WP_003407562.1.33028 WP_003407562.1.33035 WP_003407562.1.33054 WP_003407562.1.33082 WP_003407562.1.33141 WP_003407562.1.33148 WP_003407562.1.33155 WP_003407562.1.33168 WP_003407562.1.3321 WP_003407562.1.33215 WP_003407562.1.3325 WP_003407562.1.3327 WP_003407562.1.33278 WP_003407562.1.33288 WP_003407562.1.3331 WP_003407562.1.33319 WP_003407562.1.3333 WP_003407562.1.33393 WP_003407562.1.33403 WP_003407562.1.33452 WP_003407562.1.33467 WP_003407562.1.33477 WP_003407562.1.3349 WP_003407562.1.33519 WP_003407562.1.33542 WP_003407562.1.33601 WP_003407562.1.33602 WP_003407562.1.33633 WP_003407562.1.33646 WP_003407562.1.33673 WP_003407562.1.3369 WP_003407562.1.33705 WP_003407562.1.33762 WP_003407562.1.33783 WP_003407562.1.33789 WP_003407562.1.3383 WP_003407562.1.33832 WP_003407562.1.33839 WP_003407562.1.33848 WP_003407562.1.3387 WP_003407562.1.33886 WP_003407562.1.33895 WP_003407562.1.33906 WP_003407562.1.33912 WP_003407562.1.33954 WP_003407562.1.3399 WP_003407562.1.34042 WP_003407562.1.3405 WP_003407562.1.34055 WP_003407562.1.34056 WP_003407562.1.34065 WP_003407562.1.3408 WP_003407562.1.34090 WP_003407562.1.34109 WP_003407562.1.34111 WP_003407562.1.34131 WP_003407562.1.34152 WP_003407562.1.34153 WP_003407562.1.34163 WP_003407562.1.34181 WP_003407562.1.34197 WP_003407562.1.34198 WP_003407562.1.34215 WP_003407562.1.34219 WP_003407562.1.34255 WP_003407562.1.34260 WP_003407562.1.34275 WP_003407562.1.343 WP_003407562.1.34347 WP_003407562.1.34358 WP_003407562.1.34392 WP_003407562.1.344 WP_003407562.1.34428 WP_003407562.1.3443 WP_003407562.1.34435 WP_003407562.1.34446 WP_003407562.1.34499 WP_003407562.1.34505 WP_003407562.1.34516 WP_003407562.1.34529 WP_003407562.1.34551 WP_003407562.1.34563 WP_003407562.1.34576 WP_003407562.1.34581 WP_003407562.1.34588 WP_003407562.1.34596 WP_003407562.1.34599 WP_003407562.1.34639 WP_003407562.1.34673 WP_003407562.1.34724 WP_003407562.1.34740 WP_003407562.1.34755 WP_003407562.1.34777 WP_003407562.1.34783 WP_003407562.1.34841 WP_003407562.1.34908 WP_003407562.1.34919 WP_003407562.1.3492 WP_003407562.1.34933 WP_003407562.1.34945 WP_003407562.1.34946 WP_003407562.1.34954 WP_003407562.1.34960 WP_003407562.1.34961 WP_003407562.1.34965 WP_003407562.1.34968 WP_003407562.1.35023 WP_003407562.1.35069 WP_003407562.1.35072 WP_003407562.1.35078 WP_003407562.1.35100 WP_003407562.1.35146 WP_003407562.1.35156 WP_003407562.1.35160 WP_003407562.1.35162 WP_003407562.1.35173 WP_003407562.1.35176 WP_003407562.1.3520 WP_003407562.1.35213 WP_003407562.1.35221 WP_003407562.1.35246 WP_003407562.1.35278 WP_003407562.1.35301 WP_003407562.1.35311 WP_003407562.1.35312 WP_003407562.1.35317 WP_003407562.1.35319 WP_003407562.1.35347 WP_003407562.1.35363 WP_003407562.1.35382 WP_003407562.1.35385 WP_003407562.1.35396 WP_003407562.1.35397 WP_003407562.1.35403 WP_003407562.1.35426 WP_003407562.1.35439 WP_003407562.1.35455 WP_003407562.1.3548 WP_003407562.1.35484 WP_003407562.1.35492 WP_003407562.1.3553 WP_003407562.1.35553 WP_003407562.1.35555 WP_003407562.1.35561 WP_003407562.1.35602 WP_003407562.1.35610 WP_003407562.1.35635 WP_003407562.1.35657 WP_003407562.1.35680 WP_003407562.1.35687 WP_003407562.1.35689 WP_003407562.1.35707 WP_003407562.1.35732 WP_003407562.1.35754 WP_003407562.1.35767 WP_003407562.1.35770 WP_003407562.1.35771 WP_003407562.1.35780 WP_003407562.1.35805 WP_003407562.1.35811 WP_003407562.1.3584 WP_003407562.1.35848 WP_003407562.1.35864 WP_003407562.1.35874 WP_003407562.1.35876 WP_003407562.1.35897 WP_003407562.1.35899 WP_003407562.1.35923 WP_003407562.1.3593 WP_003407562.1.35954 WP_003407562.1.36005 WP_003407562.1.36014 WP_003407562.1.36023 WP_003407562.1.36051 WP_003407562.1.36053 WP_003407562.1.36075 WP_003407562.1.36089 WP_003407562.1.36097 WP_003407562.1.36098 WP_003407562.1.36116 WP_003407562.1.36145 WP_003407562.1.36156 WP_003407562.1.36205 WP_003407562.1.36228 WP_003407562.1.36246 WP_003407562.1.36252 WP_003407562.1.36260 WP_003407562.1.36270 WP_003407562.1.36271 WP_003407562.1.36303 WP_003407562.1.36309 WP_003407562.1.36315 WP_003407562.1.36319 WP_003407562.1.36321 WP_003407562.1.36326 WP_003407562.1.3634 WP_003407562.1.36356 WP_003407562.1.36357 WP_003407562.1.3636 WP_003407562.1.36385 WP_003407562.1.36399 WP_003407562.1.36436 WP_003407562.1.36465 WP_003407562.1.36469 WP_003407562.1.36473 WP_003407562.1.36485 WP_003407562.1.36508 WP_003407562.1.36540 WP_003407562.1.36561 WP_003407562.1.36571 WP_003407562.1.36573 WP_003407562.1.36578 WP_003407562.1.36585 WP_003407562.1.36597 WP_003407562.1.36614 WP_003407562.1.36657 WP_003407562.1.36674 WP_003407562.1.36720 WP_003407562.1.36727 WP_003407562.1.36733 WP_003407562.1.36785 WP_003407562.1.36810 WP_003407562.1.36844 WP_003407562.1.36851 WP_003407562.1.36862 WP_003407562.1.36893 WP_003407562.1.36901 WP_003407562.1.36921 WP_003407562.1.36935 WP_003407562.1.36941 WP_003407562.1.3695 WP_003407562.1.36951 WP_003407562.1.36968 WP_003407562.1.3700 WP_003407562.1.37004 WP_003407562.1.37012 WP_003407562.1.37071 WP_003407562.1.37088 WP_003407562.1.37131 WP_003407562.1.37157 WP_003407562.1.37175 WP_003407562.1.37188 WP_003407562.1.37213 WP_003407562.1.37229 WP_003407562.1.3724 WP_003407562.1.37277 WP_003407562.1.37305 WP_003407562.1.37330 WP_003407562.1.37389 WP_003407562.1.37400 WP_003407562.1.37440 WP_003407562.1.37459 WP_003407562.1.37468 WP_003407562.1.37475 WP_003407562.1.37484 WP_003407562.1.37601 WP_003407562.1.37612 WP_003407562.1.37632 WP_003407562.1.37643 WP_003407562.1.37655 WP_003407562.1.37660 WP_003407562.1.37674 WP_003407562.1.37700 WP_003407562.1.37701 WP_003407562.1.37709 WP_003407562.1.37711 WP_003407562.1.37721 WP_003407562.1.37722 WP_003407562.1.37747 WP_003407562.1.37765 WP_003407562.1.37772 WP_003407562.1.37804 WP_003407562.1.37809 WP_003407562.1.37859 WP_003407562.1.37877 WP_003407562.1.37912 WP_003407562.1.37913 WP_003407562.1.37943 WP_003407562.1.37950 WP_003407562.1.37973 WP_003407562.1.37975 WP_003407562.1.37983 WP_003407562.1.38 WP_003407562.1.38002 WP_003407562.1.3802 WP_003407562.1.38039 WP_003407562.1.38040 WP_003407562.1.38067 WP_003407562.1.38068 WP_003407562.1.38135 WP_003407562.1.38138 WP_003407562.1.38144 WP_003407562.1.38158 WP_003407562.1.38159 WP_003407562.1.38210 WP_003407562.1.38233 WP_003407562.1.38240 WP_003407562.1.38299 WP_003407562.1.38332 WP_003407562.1.38347 WP_003407562.1.38354 WP_003407562.1.38380 WP_003407562.1.38384 WP_003407562.1.38389 WP_003407562.1.38398 WP_003407562.1.38418 WP_003407562.1.38421 WP_003407562.1.38466 WP_003407562.1.38477 WP_003407562.1.38483 WP_003407562.1.3849 WP_003407562.1.385 WP_003407562.1.38530 WP_003407562.1.38535 WP_003407562.1.38539 WP_003407562.1.38594 WP_003407562.1.38601 WP_003407562.1.38638 WP_003407562.1.38639 WP_003407562.1.38646 WP_003407562.1.38648 WP_003407562.1.38654 WP_003407562.1.38659 WP_003407562.1.38660 WP_003407562.1.38666 WP_003407562.1.38671 WP_003407562.1.38672 WP_003407562.1.38750 WP_003407562.1.38772 WP_003407562.1.38812 WP_003407562.1.38821 WP_003407562.1.38844 WP_003407562.1.38863 WP_003407562.1.38865 WP_003407562.1.38873 WP_003407562.1.3889 WP_003407562.1.38894 WP_003407562.1.38909 WP_003407562.1.38939 WP_003407562.1.38974 WP_003407562.1.38975 WP_003407562.1.38991 WP_003407562.1.39025 WP_003407562.1.39070 WP_003407562.1.39072 WP_003407562.1.39095 WP_003407562.1.39106 WP_003407562.1.39165 WP_003407562.1.39174 WP_003407562.1.39176 WP_003407562.1.39178 WP_003407562.1.39190 WP_003407562.1.39201 WP_003407562.1.39207 WP_003407562.1.39211 WP_003407562.1.39236 WP_003407562.1.39239 WP_003407562.1.39252 WP_003407562.1.39288 WP_003407562.1.39295 WP_003407562.1.39306 WP_003407562.1.39359 WP_003407562.1.39364 WP_003407562.1.39400 WP_003407562.1.39447 WP_003407562.1.3945 WP_003407562.1.39450 WP_003407562.1.3949 WP_003407562.1.39521 WP_003407562.1.39560 WP_003407562.1.39592 WP_003407562.1.39593 WP_003407562.1.396 WP_003407562.1.3960 WP_003407562.1.39616 WP_003407562.1.39654 WP_003407562.1.39657 WP_003407562.1.39661 WP_003407562.1.39674 WP_003407562.1.39678 WP_003407562.1.3968 WP_003407562.1.39694 WP_003407562.1.3971 WP_003407562.1.39718 WP_003407562.1.39728 WP_003407562.1.39739 WP_003407562.1.39748 WP_003407562.1.39751 WP_003407562.1.39759 WP_003407562.1.39801 WP_003407562.1.39804 WP_003407562.1.39848 WP_003407562.1.39877 WP_003407562.1.39925 WP_003407562.1.3994 WP_003407562.1.39959 WP_003407562.1.3996 WP_003407562.1.39960 WP_003407562.1.3997 WP_003407562.1.39980 WP_003407562.1.40000 WP_003407562.1.40028 WP_003407562.1.40029 WP_003407562.1.4003 WP_003407562.1.40094 WP_003407562.1.40096 WP_003407562.1.40150 WP_003407562.1.40156 WP_003407562.1.40174 WP_003407562.1.40186 WP_003407562.1.40276 WP_003407562.1.40277 WP_003407562.1.40323 WP_003407562.1.40336 WP_003407562.1.40353 WP_003407562.1.4036 WP_003407562.1.40372 WP_003407562.1.40402 WP_003407562.1.40413 WP_003407562.1.40440 WP_003407562.1.40446 WP_003407562.1.40451 WP_003407562.1.40455 WP_003407562.1.40523 WP_003407562.1.40543 WP_003407562.1.40641 WP_003407562.1.40646 WP_003407562.1.40651 WP_003407562.1.40653 WP_003407562.1.4067 WP_003407562.1.40705 WP_003407562.1.40723 WP_003407562.1.40731 WP_003407562.1.40735 WP_003407562.1.40795 WP_003407562.1.40799 WP_003407562.1.40852 WP_003407562.1.40876 WP_003407562.1.40881 WP_003407562.1.40922 WP_003407562.1.40948 WP_003407562.1.4095 WP_003407562.1.40956 WP_003407562.1.40957 WP_003407562.1.40964 WP_003407562.1.4097 WP_003407562.1.410 WP_003407562.1.41000 WP_003407562.1.41055 WP_003407562.1.41108 WP_003407562.1.41123 WP_003407562.1.41177 WP_003407562.1.41202 WP_003407562.1.41219 WP_003407562.1.41231 WP_003407562.1.41249 WP_003407562.1.4127 WP_003407562.1.41296 WP_003407562.1.41355 WP_003407562.1.41376 WP_003407562.1.41430 WP_003407562.1.41447 WP_003407562.1.41469 WP_003407562.1.41504 WP_003407562.1.41553 WP_003407562.1.41564 WP_003407562.1.41583 WP_003407562.1.41616 WP_003407562.1.41632 WP_003407562.1.41635 WP_003407562.1.41636 WP_003407562.1.41648 WP_003407562.1.41660 WP_003407562.1.41685 WP_003407562.1.41695 WP_003407562.1.41704 WP_003407562.1.4171 WP_003407562.1.41719 WP_003407562.1.41733 WP_003407562.1.41744 WP_003407562.1.41774 WP_003407562.1.41791 WP_003407562.1.41803 WP_003407562.1.41820 WP_003407562.1.41828 WP_003407562.1.41829 WP_003407562.1.41860 WP_003407562.1.41912 WP_003407562.1.41921 WP_003407562.1.41933 WP_003407562.1.41944 WP_003407562.1.42043 WP_003407562.1.42075 WP_003407562.1.42078 WP_003407562.1.42094 WP_003407562.1.42112 WP_003407562.1.4212 WP_003407562.1.42122 WP_003407562.1.42134 WP_003407562.1.42188 WP_003407562.1.42201 WP_003407562.1.42202 WP_003407562.1.42208 WP_003407562.1.42247 WP_003407562.1.42255 WP_003407562.1.42273 WP_003407562.1.42278 WP_003407562.1.42304 WP_003407562.1.42309 WP_003407562.1.42370 WP_003407562.1.42385 WP_003407562.1.42400 WP_003407562.1.42409 WP_003407562.1.42414 WP_003407562.1.42417 WP_003407562.1.42430 WP_003407562.1.42461 WP_003407562.1.42465 WP_003407562.1.42467 WP_003407562.1.42473 WP_003407562.1.4248 WP_003407562.1.42494 WP_003407562.1.42519 WP_003407562.1.42524 WP_003407562.1.42534 WP_003407562.1.42562 WP_003407562.1.42568 WP_003407562.1.42570 WP_003407562.1.42618 WP_003407562.1.42660 WP_003407562.1.42695 WP_003407562.1.42704 WP_003407562.1.42705 WP_003407562.1.42722 WP_003407562.1.42777 WP_003407562.1.42782 WP_003407562.1.42835 WP_003407562.1.42839 WP_003407562.1.42842 WP_003407562.1.42905 WP_003407562.1.42916 WP_003407562.1.42930 WP_003407562.1.42971 WP_003407562.1.43005 WP_003407562.1.43009 WP_003407562.1.43053 WP_003407562.1.43082 WP_003407562.1.43087 WP_003407562.1.43098 WP_003407562.1.43208 WP_003407562.1.43236 WP_003407562.1.43255 WP_003407562.1.43266 WP_003407562.1.43269 WP_003407562.1.43273 WP_003407562.1.43296 WP_003407562.1.43306 WP_003407562.1.4335 WP_003407562.1.43368 WP_003407562.1.43395 WP_003407562.1.43457 WP_003407562.1.43462 WP_003407562.1.43475 WP_003407562.1.43478 WP_003407562.1.43484 WP_003407562.1.43557 WP_003407562.1.43578 WP_003407562.1.43588 WP_003407562.1.43643 WP_003407562.1.43664 WP_003407562.1.43684 WP_003407562.1.43686 WP_003407562.1.43706 WP_003407562.1.43716 WP_003407562.1.4377 WP_003407562.1.43781 WP_003407562.1.43794 WP_003407562.1.43815 WP_003407562.1.43846 WP_003407562.1.43861 WP_003407562.1.43863 WP_003407562.1.43866 WP_003407562.1.43872 WP_003407562.1.43885 WP_003407562.1.43897 WP_003407562.1.4390 WP_003407562.1.43902 WP_003407562.1.43921 WP_003407562.1.43936 WP_003407562.1.43937 WP_003407562.1.43960 WP_003407562.1.43965 WP_003407562.1.4399 WP_003407562.1.43993 WP_003407562.1.43996 WP_003407562.1.44 WP_003407562.1.44001 WP_003407562.1.44008 WP_003407562.1.44016 WP_003407562.1.44033 WP_003407562.1.44037 WP_003407562.1.44041 WP_003407562.1.44070 WP_003407562.1.44071 WP_003407562.1.44076 WP_003407562.1.44104 WP_003407562.1.44111 WP_003407562.1.44124 WP_003407562.1.44169 WP_003407562.1.44219 WP_003407562.1.44237 WP_003407562.1.44277 WP_003407562.1.44279 WP_003407562.1.44336 WP_003407562.1.44355 WP_003407562.1.44358 WP_003407562.1.4438 WP_003407562.1.44390 WP_003407562.1.44392 WP_003407562.1.4441 WP_003407562.1.44415 WP_003407562.1.44464 WP_003407562.1.44466 WP_003407562.1.44489 WP_003407562.1.44492 WP_003407562.1.44494 WP_003407562.1.44500 WP_003407562.1.44519 WP_003407562.1.44526 WP_003407562.1.44532 WP_003407562.1.44534 WP_003407562.1.44562 WP_003407562.1.44589 WP_003407562.1.44597 WP_003407562.1.44600 WP_003407562.1.44602 WP_003407562.1.44615 WP_003407562.1.4464 WP_003407562.1.44651 WP_003407562.1.44659 WP_003407562.1.44665 WP_003407562.1.44694 WP_003407562.1.44700 WP_003407562.1.44713 WP_003407562.1.44735 WP_003407562.1.44740 WP_003407562.1.44757 WP_003407562.1.4476 WP_003407562.1.44761 WP_003407562.1.44767 WP_003407562.1.44776 WP_003407562.1.44779 WP_003407562.1.44786 WP_003407562.1.44808 WP_003407562.1.44864 WP_003407562.1.44901 WP_003407562.1.44908 WP_003407562.1.44913 WP_003407562.1.4492 WP_003407562.1.44939 WP_003407562.1.44979 WP_003407562.1.44981 WP_003407562.1.45002 WP_003407562.1.45011 WP_003407562.1.4504 WP_003407562.1.45062 WP_003407562.1.45066 WP_003407562.1.45081 WP_003407562.1.45113 WP_003407562.1.45129 WP_003407562.1.45135 WP_003407562.1.45147 WP_003407562.1.45168 WP_003407562.1.4517 WP_003407562.1.45181 WP_003407562.1.45185 WP_003407562.1.45192 WP_003407562.1.45200 WP_003407562.1.45205 WP_003407562.1.45211 WP_003407562.1.45249 WP_003407562.1.4526 WP_003407562.1.45286 WP_003407562.1.45326 WP_003407562.1.45347 WP_003407562.1.45374 WP_003407562.1.45390 WP_003407562.1.454 WP_003407562.1.45407 WP_003407562.1.45451 WP_003407562.1.45453 WP_003407562.1.45460 WP_003407562.1.45463 WP_003407562.1.45470 WP_003407562.1.45474 WP_003407562.1.45491 WP_003407562.1.45510 WP_003407562.1.45563 WP_003407562.1.45584 WP_003407562.1.45590 WP_003407562.1.45619 WP_003407562.1.45626 WP_003407562.1.45631 WP_003407562.1.45666 WP_003407562.1.45697 WP_003407562.1.4571 WP_003407562.1.45731 WP_003407562.1.45743 WP_003407562.1.45765 WP_003407562.1.45776 WP_003407562.1.45783 WP_003407562.1.45805 WP_003407562.1.45815 WP_003407562.1.45849 WP_003407562.1.45867 WP_003407562.1.45884 WP_003407562.1.4590 WP_003407562.1.45923 WP_003407562.1.45926 WP_003407562.1.45963 WP_003407562.1.45989 WP_003407562.1.45992 WP_003407562.1.46025 WP_003407562.1.46083 WP_003407562.1.46092 WP_003407562.1.46100 WP_003407562.1.46101 WP_003407562.1.46103 WP_003407562.1.46107 WP_003407562.1.46127 WP_003407562.1.46128 WP_003407562.1.46129 WP_003407562.1.46141 WP_003407562.1.46150 WP_003407562.1.46201 WP_003407562.1.46226 WP_003407562.1.4624 WP_003407562.1.46253 WP_003407562.1.46268 WP_003407562.1.46285 WP_003407562.1.46313 WP_003407562.1.46336 WP_003407562.1.46365 WP_003407562.1.46370 WP_003407562.1.46381 WP_003407562.1.46402 WP_003407562.1.46411 WP_003407562.1.4644 WP_003407562.1.46442 WP_003407562.1.46453 WP_003407562.1.46463 WP_003407562.1.46478 WP_003407562.1.46492 WP_003407562.1.46521 WP_003407562.1.4653 WP_003407562.1.46532 WP_003407562.1.46539 WP_003407562.1.46568 WP_003407562.1.46585 WP_003407562.1.46609 WP_003407562.1.46613 WP_003407562.1.46625 WP_003407562.1.46642 WP_003407562.1.46647 WP_003407562.1.46674 WP_003407562.1.46724 WP_003407562.1.46758 WP_003407562.1.46773 WP_003407562.1.46777 WP_003407562.1.46786 WP_003407562.1.46792 WP_003407562.1.46847 WP_003407562.1.46851 WP_003407562.1.4687 WP_003407562.1.46936 WP_003407562.1.46980 WP_003407562.1.47011 WP_003407562.1.47012 WP_003407562.1.47066 WP_003407562.1.47077 WP_003407562.1.47083 WP_003407562.1.47106 WP_003407562.1.47142 WP_003407562.1.47147 WP_003407562.1.47166 WP_003407562.1.47178 WP_003407562.1.47179 WP_003407562.1.47194 WP_003407562.1.47207 WP_003407562.1.47210 WP_003407562.1.47261 WP_003407562.1.47262 WP_003407562.1.47402 WP_003407562.1.47423 WP_003407562.1.47467 WP_003407562.1.47502 WP_003407562.1.4751 WP_003407562.1.47511 WP_003407562.1.47537 WP_003407562.1.47540 WP_003407562.1.47568 WP_003407562.1.47572 WP_003407562.1.47588 WP_003407562.1.47636 WP_003407562.1.4764 WP_003407562.1.47653 WP_003407562.1.47679 WP_003407562.1.47681 WP_003407562.1.47690 WP_003407562.1.4771 WP_003407562.1.47717 WP_003407562.1.47743 WP_003407562.1.47754 WP_003407562.1.47773 WP_003407562.1.47776 WP_003407562.1.47780 WP_003407562.1.47805 WP_003407562.1.47832 WP_003407562.1.47847 WP_003407562.1.47858 WP_003407562.1.47861 WP_003407562.1.47868 WP_003407562.1.47893 WP_003407562.1.47899 WP_003407562.1.479 WP_003407562.1.47912 WP_003407562.1.47913 WP_003407562.1.47926 WP_003407562.1.4794 WP_003407562.1.47943 WP_003407562.1.47944 WP_003407562.1.47959 WP_003407562.1.47974 WP_003407562.1.47993 WP_003407562.1.48004 WP_003407562.1.48039 WP_003407562.1.48050 WP_003407562.1.48084 WP_003407562.1.48097 WP_003407562.1.48101 WP_003407562.1.48109 WP_003407562.1.4813 WP_003407562.1.48130 WP_003407562.1.48135 WP_003407562.1.48143 WP_003407562.1.48152 WP_003407562.1.48155 WP_003407562.1.48170 WP_003407562.1.48173 WP_003407562.1.48177 WP_003407562.1.48185 WP_003407562.1.48204 WP_003407562.1.48219 WP_003407562.1.4823 WP_003407562.1.48240 WP_003407562.1.48256 WP_003407562.1.48264 WP_003407562.1.48287 WP_003407562.1.48330 WP_003407562.1.48333 WP_003407562.1.48348 WP_003407562.1.48354 WP_003407562.1.48372 WP_003407562.1.48383 WP_003407562.1.48388 WP_003407562.1.48419 WP_003407562.1.48423 WP_003407562.1.48443 WP_003407562.1.48450 WP_003407562.1.48462 WP_003407562.1.48543 WP_003407562.1.48550 WP_003407562.1.48605 WP_003407562.1.48618 WP_003407562.1.4863 WP_003407562.1.48648 WP_003407562.1.48658 WP_003407562.1.48666 WP_003407562.1.48687 WP_003407562.1.48779 WP_003407562.1.4878 WP_003407562.1.48798 WP_003407562.1.48802 WP_003407562.1.48826 WP_003407562.1.48831 WP_003407562.1.48843 WP_003407562.1.48857 WP_003407562.1.4890 WP_003407562.1.48946 WP_003407562.1.48979 WP_003407562.1.49017 WP_003407562.1.49048 WP_003407562.1.49059 WP_003407562.1.4906 WP_003407562.1.4907 WP_003407562.1.49103 WP_003407562.1.49110 WP_003407562.1.49111 WP_003407562.1.49112 WP_003407562.1.4919 WP_003407562.1.49251 WP_003407562.1.49254 WP_003407562.1.49263 WP_003407562.1.49291 WP_003407562.1.49296 WP_003407562.1.49335 WP_003407562.1.49337 WP_003407562.1.49419 WP_003407562.1.49426 WP_003407562.1.49437 WP_003407562.1.49439 WP_003407562.1.49474 WP_003407562.1.49506 WP_003407562.1.49516 WP_003407562.1.49523 WP_003407562.1.49526 WP_003407562.1.49532 WP_003407562.1.49588 WP_003407562.1.4959 WP_003407562.1.49678 WP_003407562.1.49687 WP_003407562.1.49699 WP_003407562.1.49709 WP_003407562.1.4971 WP_003407562.1.4972 WP_003407562.1.49736 WP_003407562.1.49746 WP_003407562.1.49764 WP_003407562.1.49773 WP_003407562.1.49796 WP_003407562.1.49814 WP_003407562.1.49815 WP_003407562.1.49816 WP_003407562.1.49839 WP_003407562.1.49857 WP_003407562.1.49878 WP_003407562.1.49880 WP_003407562.1.49944 WP_003407562.1.4999 WP_003407562.1.49990 WP_003407562.1.50068 WP_003407562.1.50077 WP_003407562.1.5008 WP_003407562.1.50081 WP_003407562.1.50122 WP_003407562.1.50126 WP_003407562.1.50149 WP_003407562.1.50162 WP_003407562.1.5018 WP_003407562.1.50194 WP_003407562.1.50218 WP_003407562.1.50235 WP_003407562.1.50249 WP_003407562.1.50265 WP_003407562.1.50271 WP_003407562.1.50324 WP_003407562.1.50347 WP_003407562.1.50372 WP_003407562.1.50398 WP_003407562.1.50407 WP_003407562.1.50444 WP_003407562.1.50466 WP_003407562.1.50472 WP_003407562.1.5048 WP_003407562.1.50498 WP_003407562.1.5050 WP_003407562.1.50540 WP_003407562.1.50554 WP_003407562.1.50557 WP_003407562.1.50601 WP_003407562.1.50610 WP_003407562.1.50632 WP_003407562.1.50633 WP_003407562.1.50642 WP_003407562.1.50655 WP_003407562.1.50659 WP_003407562.1.50683 WP_003407562.1.50689 WP_003407562.1.50692 WP_003407562.1.50714 WP_003407562.1.50729 WP_003407562.1.50756 WP_003407562.1.50784 WP_003407562.1.50794 WP_003407562.1.50841 WP_003407562.1.50860 WP_003407562.1.50868 WP_003407562.1.50877 WP_003407562.1.5096 WP_003407562.1.50981 WP_003407562.1.50987 WP_003407562.1.51003 WP_003407562.1.51009 WP_003407562.1.51037 WP_003407562.1.51074 WP_003407562.1.51082 WP_003407562.1.51101 WP_003407562.1.51116 WP_003407562.1.51149 WP_003407562.1.51157 WP_003407562.1.51213 WP_003407562.1.51232 WP_003407562.1.51239 WP_003407562.1.51247 WP_003407562.1.51266 WP_003407562.1.51279 WP_003407562.1.51291 WP_003407562.1.51294 WP_003407562.1.51301 WP_003407562.1.51329 WP_003407562.1.51391 WP_003407562.1.51422 WP_003407562.1.51445 WP_003407562.1.51455 WP_003407562.1.51466 WP_003407562.1.51468 WP_003407562.1.51478 WP_003407562.1.51497 WP_003407562.1.51520 WP_003407562.1.51593 WP_003407562.1.51628 WP_003407562.1.5164 WP_003407562.1.51647 WP_003407562.1.51660 WP_003407562.1.51696 WP_003407562.1.51721 WP_003407562.1.51788 WP_003407562.1.51795 WP_003407562.1.51801 WP_003407562.1.51817 WP_003407562.1.51819 WP_003407562.1.51854 WP_003407562.1.51923 WP_003407562.1.51942 WP_003407562.1.51948 WP_003407562.1.51963 WP_003407562.1.51969 WP_003407562.1.52000 WP_003407562.1.52001 WP_003407562.1.52003 WP_003407562.1.52006 WP_003407562.1.52036 WP_003407562.1.52038 WP_003407562.1.52046 WP_003407562.1.52059 WP_003407562.1.52069 WP_003407562.1.52082 WP_003407562.1.52102 WP_003407562.1.52106 WP_003407562.1.52166 WP_003407562.1.52168 WP_003407562.1.52173 WP_003407562.1.52178 WP_003407562.1.52206 WP_003407562.1.52216 WP_003407562.1.52238 WP_003407562.1.52241 WP_003407562.1.52280 WP_003407562.1.52314 WP_003407562.1.52385 WP_003407562.1.52390 WP_003407562.1.524 WP_003407562.1.52460 WP_003407562.1.52485 WP_003407562.1.52486 WP_003407562.1.52495 WP_003407562.1.52504 WP_003407562.1.52522 WP_003407562.1.52531 WP_003407562.1.52533 WP_003407562.1.52545 WP_003407562.1.52553 WP_003407562.1.52563 WP_003407562.1.52564 WP_003407562.1.52574 WP_003407562.1.52641 WP_003407562.1.52673 WP_003407562.1.52674 WP_003407562.1.52708 WP_003407562.1.52713 WP_003407562.1.52761 WP_003407562.1.52778 WP_003407562.1.52791 WP_003407562.1.52797 WP_003407562.1.52818 WP_003407562.1.52872 WP_003407562.1.52873 WP_003407562.1.52891 WP_003407562.1.52892 WP_003407562.1.52909 WP_003407562.1.52970 WP_003407562.1.52998 WP_003407562.1.53053 WP_003407562.1.53056 WP_003407562.1.5306 WP_003407562.1.53088 WP_003407562.1.5309 WP_003407562.1.531 WP_003407562.1.53117 WP_003407562.1.53118 WP_003407562.1.53142 WP_003407562.1.53143 WP_003407562.1.53157 WP_003407562.1.53167 WP_003407562.1.53200 WP_003407562.1.53204 WP_003407562.1.53213 WP_003407562.1.53217 WP_003407562.1.53226 WP_003407562.1.53229 WP_003407562.1.53230 WP_003407562.1.53237 WP_003407562.1.53254 WP_003407562.1.53257 WP_003407562.1.5327 WP_003407562.1.53276 WP_003407562.1.53278 WP_003407562.1.533 WP_003407562.1.53302 WP_003407562.1.53306 WP_003407562.1.5334 WP_003407562.1.5335 WP_003407562.1.53353 WP_003407562.1.53381 WP_003407562.1.53413 WP_003407562.1.53458 WP_003407562.1.53460 WP_003407562.1.53480 WP_003407562.1.53517 WP_003407562.1.53522 WP_003407562.1.53526 WP_003407562.1.53553 WP_003407562.1.53606 WP_003407562.1.53609 WP_003407562.1.53628 WP_003407562.1.53643 WP_003407562.1.53667 WP_003407562.1.53679 WP_003407562.1.53715 WP_003407562.1.53730 WP_003407562.1.53742 WP_003407562.1.53743 WP_003407562.1.53754 WP_003407562.1.53775 WP_003407562.1.53787 WP_003407562.1.53803 WP_003407562.1.53818 WP_003407562.1.53822 WP_003407562.1.53853 WP_003407562.1.53888 WP_003407562.1.53900 WP_003407562.1.53912 WP_003407562.1.53914 WP_003407562.1.53952 WP_003407562.1.53973 WP_003407562.1.5398 WP_003407562.1.5408 WP_003407562.1.54089 WP_003407562.1.54093 WP_003407562.1.54099 WP_003407562.1.54112 WP_003407562.1.54125 WP_003407562.1.54141 WP_003407562.1.54162 WP_003407562.1.54179 WP_003407562.1.54218 WP_003407562.1.54225 WP_003407562.1.54227 WP_003407562.1.54232 WP_003407562.1.54241 WP_003407562.1.54245 WP_003407562.1.54247 WP_003407562.1.54260 WP_003407562.1.54275 WP_003407562.1.54280 WP_003407562.1.5429 WP_003407562.1.54294 WP_003407562.1.54314 WP_003407562.1.54347 WP_003407562.1.54351 WP_003407562.1.54370 WP_003407562.1.54428 WP_003407562.1.54449 WP_003407562.1.54494 WP_003407562.1.54502 WP_003407562.1.54514 WP_003407562.1.54519 WP_003407562.1.5452 WP_003407562.1.54531 WP_003407562.1.54537 WP_003407562.1.54553 WP_003407562.1.54555 WP_003407562.1.54575 WP_003407562.1.54633 WP_003407562.1.54686 WP_003407562.1.54687 WP_003407562.1.54705 WP_003407562.1.54730 WP_003407562.1.54732 WP_003407562.1.5475 WP_003407562.1.54797 WP_003407562.1.54807 WP_003407562.1.54836 WP_003407562.1.54838 WP_003407562.1.54860 WP_003407562.1.54888 WP_003407562.1.54905 WP_003407562.1.54909 WP_003407562.1.54937 WP_003407562.1.54939 WP_003407562.1.54944 WP_003407562.1.54945 WP_003407562.1.54953 WP_003407562.1.54964 WP_003407562.1.55015 WP_003407562.1.55022 WP_003407562.1.55023 WP_003407562.1.55051 WP_003407562.1.55072 WP_003407562.1.55088 WP_003407562.1.55106 WP_003407562.1.55126 WP_003407562.1.55128 WP_003407562.1.55140 WP_003407562.1.55150 WP_003407562.1.55210 WP_003407562.1.55227 WP_003407562.1.55248 WP_003407562.1.55257 WP_003407562.1.55258 WP_003407562.1.55267 WP_003407562.1.55279 WP_003407562.1.55307 WP_003407562.1.55326 WP_003407562.1.55328 WP_003407562.1.5533 WP_003407562.1.55345 WP_003407562.1.55396 WP_003407562.1.55398 WP_003407562.1.55441 WP_003407562.1.55459 WP_003407562.1.55501 WP_003407562.1.55504 WP_003407562.1.55578 WP_003407562.1.55626 WP_003407562.1.55641 WP_003407562.1.5569 WP_003407562.1.55723 WP_003407562.1.55735 WP_003407562.1.5574 WP_003407562.1.55772 WP_003407562.1.55802 WP_003407562.1.55807 WP_003407562.1.55819 WP_003407562.1.55821 WP_003407562.1.5583 WP_003407562.1.55849 WP_003407562.1.55856 WP_003407562.1.55860 WP_003407562.1.55882 WP_003407562.1.55883 WP_003407562.1.55894 WP_003407562.1.55902 WP_003407562.1.55908 WP_003407562.1.55909 WP_003407562.1.5591 WP_003407562.1.55961 WP_003407562.1.55977 WP_003407562.1.55983 WP_003407562.1.56028 WP_003407562.1.56057 WP_003407562.1.56060 WP_003407562.1.56107 WP_003407562.1.56132 WP_003407562.1.56163 WP_003407562.1.56167 WP_003407562.1.56178 WP_003407562.1.56287 WP_003407562.1.56292 WP_003407562.1.56327 WP_003407562.1.56341 WP_003407562.1.56359 WP_003407562.1.56365 WP_003407562.1.56394 WP_003407562.1.56443 WP_003407562.1.56473 WP_003407562.1.56478 WP_003407562.1.56500 WP_003407562.1.56517 WP_003407562.1.56534 WP_003407562.1.5656 WP_003407562.1.56577 WP_003407562.1.56593 WP_003407562.1.56625 WP_003407562.1.56637 WP_003407562.1.56670 WP_003407562.1.56697 WP_003407562.1.567 WP_003407562.1.56701 WP_003407562.1.56709 WP_003407562.1.56729 WP_003407562.1.56743 WP_003407562.1.56755 WP_003407562.1.56764 WP_003407562.1.56769 WP_003407562.1.56770 WP_003407562.1.56795 WP_003407562.1.56827 WP_003407562.1.56839 WP_003407562.1.56863 WP_003407562.1.56868 WP_003407562.1.56869 WP_003407562.1.56915 WP_003407562.1.56926 WP_003407562.1.56961 WP_003407562.1.56971 WP_003407562.1.56972 WP_003407562.1.57023 WP_003407562.1.57035 WP_003407562.1.57077 WP_003407562.1.57087 WP_003407562.1.57094 WP_003407562.1.57134 WP_003407562.1.57151 WP_003407562.1.57169 WP_003407562.1.57208 WP_003407562.1.57212 WP_003407562.1.5724 WP_003407562.1.5725 WP_003407562.1.5727 WP_003407562.1.57273 WP_003407562.1.573 WP_003407562.1.57314 WP_003407562.1.57326 WP_003407562.1.57328 WP_003407562.1.57331 WP_003407562.1.57340 WP_003407562.1.57351 WP_003407562.1.57352 WP_003407562.1.57380 WP_003407562.1.57430 WP_003407562.1.5744 WP_003407562.1.57440 WP_003407562.1.5745 WP_003407562.1.57461 WP_003407562.1.57469 WP_003407562.1.57489 WP_003407562.1.575 WP_003407562.1.57509 WP_003407562.1.57519 WP_003407562.1.57525 WP_003407562.1.57551 WP_003407562.1.5758 WP_003407562.1.57596 WP_003407562.1.57604 WP_003407562.1.57616 WP_003407562.1.57617 WP_003407562.1.57619 WP_003407562.1.57627 WP_003407562.1.57642 WP_003407562.1.57658 WP_003407562.1.57667 WP_003407562.1.57675 WP_003407562.1.57689 WP_003407562.1.57708 WP_003407562.1.57794 WP_003407562.1.57821 WP_003407562.1.57825 WP_003407562.1.57843 WP_003407562.1.57906 WP_003407562.1.57924 WP_003407562.1.57926 WP_003407562.1.57930 WP_003407562.1.57957 WP_003407562.1.57960 WP_003407562.1.57991 WP_003407562.1.58000 WP_003407562.1.58086 WP_003407562.1.58101 WP_003407562.1.58103 WP_003407562.1.58108 WP_003407562.1.5811 WP_003407562.1.58121 WP_003407562.1.58145 WP_003407562.1.58164 WP_003407562.1.58174 WP_003407562.1.582 WP_003407562.1.58202 WP_003407562.1.58209 WP_003407562.1.58215 WP_003407562.1.5824 WP_003407562.1.58250 WP_003407562.1.58259 WP_003407562.1.58283 WP_003407562.1.58288 WP_003407562.1.5830 WP_003407562.1.58303 WP_003407562.1.58311 WP_003407562.1.58330 WP_003407562.1.58359 WP_003407562.1.58386 WP_003407562.1.58393 WP_003407562.1.58431 WP_003407562.1.5844 WP_003407562.1.58457 WP_003407562.1.58488 WP_003407562.1.58518 WP_003407562.1.58534 WP_003407562.1.58559 WP_003407562.1.58567 WP_003407562.1.58573 WP_003407562.1.58602 WP_003407562.1.58612 WP_003407562.1.58619 WP_003407562.1.58630 WP_003407562.1.5865 WP_003407562.1.58671 WP_003407562.1.58690 WP_003407562.1.58702 WP_003407562.1.58743 WP_003407562.1.58754 WP_003407562.1.5879 WP_003407562.1.5881 WP_003407562.1.58824 WP_003407562.1.58848 WP_003407562.1.58857 WP_003407562.1.58891 WP_003407562.1.58892 WP_003407562.1.5890 WP_003407562.1.58904 WP_003407562.1.58921 WP_003407562.1.58930 WP_003407562.1.58939 WP_003407562.1.58941 WP_003407562.1.58953 WP_003407562.1.58961 WP_003407562.1.5898 WP_003407562.1.59025 WP_003407562.1.59029 WP_003407562.1.59037 WP_003407562.1.59044 WP_003407562.1.59085 WP_003407562.1.59088 WP_003407562.1.59112 WP_003407562.1.59130 WP_003407562.1.5914 WP_003407562.1.59147 WP_003407562.1.59166 WP_003407562.1.59205 WP_003407562.1.59209 WP_003407562.1.59237 WP_003407562.1.59240 WP_003407562.1.59253 WP_003407562.1.59254 WP_003407562.1.59262 WP_003407562.1.59270 WP_003407562.1.5928 WP_003407562.1.59304 WP_003407562.1.59305 WP_003407562.1.59309 WP_003407562.1.59316 WP_003407562.1.59326 WP_003407562.1.59328 WP_003407562.1.59333 WP_003407562.1.59338 WP_003407562.1.59388 WP_003407562.1.59428 WP_003407562.1.59487 WP_003407562.1.59537 WP_003407562.1.59561 WP_003407562.1.59677 WP_003407562.1.59722 WP_003407562.1.59727 WP_003407562.1.59732 WP_003407562.1.59738 WP_003407562.1.59750 WP_003407562.1.59757 WP_003407562.1.59761 WP_003407562.1.59808 WP_003407562.1.59850 WP_003407562.1.59856 WP_003407562.1.59860 WP_003407562.1.59861 WP_003407562.1.5987 WP_003407562.1.59878 WP_003407562.1.59888 WP_003407562.1.5996 WP_003407562.1.59961 WP_003407562.1.59974 WP_003407562.1.6000 WP_003407562.1.60007 WP_003407562.1.60016 WP_003407562.1.6003 WP_003407562.1.60047 WP_003407562.1.6007 WP_003407562.1.60091 WP_003407562.1.60121 WP_003407562.1.60125 WP_003407562.1.60135 WP_003407562.1.60139 WP_003407562.1.60152 WP_003407562.1.60171 WP_003407562.1.60197 WP_003407562.1.6020 WP_003407562.1.60205 WP_003407562.1.60207 WP_003407562.1.60215 WP_003407562.1.60217 WP_003407562.1.60267 WP_003407562.1.60288 WP_003407562.1.60291 WP_003407562.1.60301 WP_003407562.1.60305 WP_003407562.1.60312 WP_003407562.1.60313 WP_003407562.1.60314 WP_003407562.1.60367 WP_003407562.1.60376 WP_003407562.1.60403 WP_003407562.1.60413 WP_003407562.1.60421 WP_003407562.1.60451 WP_003407562.1.60460 WP_003407562.1.60479 WP_003407562.1.60487 WP_003407562.1.60512 WP_003407562.1.60573 WP_003407562.1.60583 WP_003407562.1.60632 WP_003407562.1.60657 WP_003407562.1.60687 WP_003407562.1.60689 WP_003407562.1.60727 WP_003407562.1.60738 WP_003407562.1.60763 WP_003407562.1.6077 WP_003407562.1.60791 WP_003407562.1.60834 WP_003407562.1.60870 WP_003407562.1.60878 WP_003407562.1.60879 WP_003407562.1.60913 WP_003407562.1.60978 WP_003407562.1.61000 WP_003407562.1.61001 WP_003407562.1.61012 WP_003407562.1.61014 WP_003407562.1.61015 WP_003407562.1.61037 WP_003407562.1.61052 WP_003407562.1.61065 WP_003407562.1.61100 WP_003407562.1.61101 WP_003407562.1.61138 WP_003407562.1.61142 WP_003407562.1.61198 WP_003407562.1.612 WP_003407562.1.61234 WP_003407562.1.61256 WP_003407562.1.61281 WP_003407562.1.61314 WP_003407562.1.61321 WP_003407562.1.61326 WP_003407562.1.61328 WP_003407562.1.61368 WP_003407562.1.61391 WP_003407562.1.61406 WP_003407562.1.61409 WP_003407562.1.61420 WP_003407562.1.61422 WP_003407562.1.61425 WP_003407562.1.61428 WP_003407562.1.61469 WP_003407562.1.61494 WP_003407562.1.61522 WP_003407562.1.61552 WP_003407562.1.61557 WP_003407562.1.61567 WP_003407562.1.61571 WP_003407562.1.61573 WP_003407562.1.61584 WP_003407562.1.61586 WP_003407562.1.6159 WP_003407562.1.61592 WP_003407562.1.6160 WP_003407562.1.61614 WP_003407562.1.6163 WP_003407562.1.61655 WP_003407562.1.61665 WP_003407562.1.61669 WP_003407562.1.61682 WP_003407562.1.61692 WP_003407562.1.61719 WP_003407562.1.61728 WP_003407562.1.61750 WP_003407562.1.61754 WP_003407562.1.61755 WP_003407562.1.61757 WP_003407562.1.61778 WP_003407562.1.6179 WP_003407562.1.61793 WP_003407562.1.61816 WP_003407562.1.61842 WP_003407562.1.61850 WP_003407562.1.61862 WP_003407562.1.61865 WP_003407562.1.61868 WP_003407562.1.61911 WP_003407562.1.61925 WP_003407562.1.61941 WP_003407562.1.61953 WP_003407562.1.61979 WP_003407562.1.61986 WP_003407562.1.61987 WP_003407562.1.61998 WP_003407562.1.62021 WP_003407562.1.62087 WP_003407562.1.62089 WP_003407562.1.62101 WP_003407562.1.62104 WP_003407562.1.6211 WP_003407562.1.62132 WP_003407562.1.62162 WP_003407562.1.62225 WP_003407562.1.62230 WP_003407562.1.62238 WP_003407562.1.62249 WP_003407562.1.62270 WP_003407562.1.62281 WP_003407562.1.62307 WP_003407562.1.6231 WP_003407562.1.62359 WP_003407562.1.62360 WP_003407562.1.62371 WP_003407562.1.62379 WP_003407562.1.62395 WP_003407562.1.62408 WP_003407562.1.62449 WP_003407562.1.62468 WP_003407562.1.6248 WP_003407562.1.62508 WP_003407562.1.62565 WP_003407562.1.62594 WP_003407562.1.62606 WP_003407562.1.62616 WP_003407562.1.62666 WP_003407562.1.62687 WP_003407562.1.62715 WP_003407562.1.62730 WP_003407562.1.62738 WP_003407562.1.62761 WP_003407562.1.62766 WP_003407562.1.62786 WP_003407562.1.62813 WP_003407562.1.62839 WP_003407562.1.62841 WP_003407562.1.62909 WP_003407562.1.62936 WP_003407562.1.6294 WP_003407562.1.6295 WP_003407562.1.62962 WP_003407562.1.63007 WP_003407562.1.63019 WP_003407562.1.63032 WP_003407562.1.63037 WP_003407562.1.63064 WP_003407562.1.63066 WP_003407562.1.63072 WP_003407562.1.6308 WP_003407562.1.63081 WP_003407562.1.63096 WP_003407562.1.63106 WP_003407562.1.6314 WP_003407562.1.63144 WP_003407562.1.63154 WP_003407562.1.63160 WP_003407562.1.63161 WP_003407562.1.63166 WP_003407562.1.63175 WP_003407562.1.63194 WP_003407562.1.6322 WP_003407562.1.63222 WP_003407562.1.63247 WP_003407562.1.6328 WP_003407562.1.63291 WP_003407562.1.63312 WP_003407562.1.63317 WP_003407562.1.63331 WP_003407562.1.63373 WP_003407562.1.63384 WP_003407562.1.63403 WP_003407562.1.63424 WP_003407562.1.63428 WP_003407562.1.6345 WP_003407562.1.63464 WP_003407562.1.63483 WP_003407562.1.63502 WP_003407562.1.63504 WP_003407562.1.63522 WP_003407562.1.63530 WP_003407562.1.63538 WP_003407562.1.63564 WP_003407562.1.63567 WP_003407562.1.63596 WP_003407562.1.63600 WP_003407562.1.63623 WP_003407562.1.63624 WP_003407562.1.63625 WP_003407562.1.63627 WP_003407562.1.63654 WP_003407562.1.63662 WP_003407562.1.63711 WP_003407562.1.63734 WP_003407562.1.63807 WP_003407562.1.63819 WP_003407562.1.63844 WP_003407562.1.63888 WP_003407562.1.63913 WP_003407562.1.63915 WP_003407562.1.63918 WP_003407562.1.63970 WP_003407562.1.64000 WP_003407562.1.64027 WP_003407562.1.64058 WP_003407562.1.64065 WP_003407562.1.6407 WP_003407562.1.64082 WP_003407562.1.64091 WP_003407562.1.64102 WP_003407562.1.64104 WP_003407562.1.64119 WP_003407562.1.64169 WP_003407562.1.64219 WP_003407562.1.6422 WP_003407562.1.64222 WP_003407562.1.64223 WP_003407562.1.64228 WP_003407562.1.64235 WP_003407562.1.64249 WP_003407562.1.6427 WP_003407562.1.64278 WP_003407562.1.64287 WP_003407562.1.64414 WP_003407562.1.64419 WP_003407562.1.6443 WP_003407562.1.64463 WP_003407562.1.64480 WP_003407562.1.64497 WP_003407562.1.64506 WP_003407562.1.64511 WP_003407562.1.64513 WP_003407562.1.64514 WP_003407562.1.64515 WP_003407562.1.64522 WP_003407562.1.64526 WP_003407562.1.64543 WP_003407562.1.6456 WP_003407562.1.64567 WP_003407562.1.64588 WP_003407562.1.64589 WP_003407562.1.64594 WP_003407562.1.64595 WP_003407562.1.64608 WP_003407562.1.64619 WP_003407562.1.64629 WP_003407562.1.6464 WP_003407562.1.64664 WP_003407562.1.64669 WP_003407562.1.64672 WP_003407562.1.64680 WP_003407562.1.64727 WP_003407562.1.64729 WP_003407562.1.64774 WP_003407562.1.64776 WP_003407562.1.64802 WP_003407562.1.64832 WP_003407562.1.6486 WP_003407562.1.64870 WP_003407562.1.64898 WP_003407562.1.64922 WP_003407562.1.64924 WP_003407562.1.6493 WP_003407562.1.64937 WP_003407562.1.64941 WP_003407562.1.64966 WP_003407562.1.64973 WP_003407562.1.65001 WP_003407562.1.65026 WP_003407562.1.65053 WP_003407562.1.65070 WP_003407562.1.65079 WP_003407562.1.65102 WP_003407562.1.65157 WP_003407562.1.65181 WP_003407562.1.65212 WP_003407562.1.65229 WP_003407562.1.6523 WP_003407562.1.65253 WP_003407562.1.65289 WP_003407562.1.65291 WP_003407562.1.65315 WP_003407562.1.65329 WP_003407562.1.65359 WP_003407562.1.6536 WP_003407562.1.65374 WP_003407562.1.65386 WP_003407562.1.65414 WP_003407562.1.65416 WP_003407562.1.65433 WP_003407562.1.65455 WP_003407562.1.65488 WP_003407562.1.65529 WP_003407562.1.65539 WP_003407562.1.65583 WP_003407562.1.65612 WP_003407562.1.65623 WP_003407562.1.65635 WP_003407562.1.65637 WP_003407562.1.65648 WP_003407562.1.65683 WP_003407562.1.65686 WP_003407562.1.65688 WP_003407562.1.65707 WP_003407562.1.65733 WP_003407562.1.65746 WP_003407562.1.65747 WP_003407562.1.65759 WP_003407562.1.65816 WP_003407562.1.65830 WP_003407562.1.65858 WP_003407562.1.65862 WP_003407562.1.65869 WP_003407562.1.65893 WP_003407562.1.65929 WP_003407562.1.65932 WP_003407562.1.65958 WP_003407562.1.65974 WP_003407562.1.66004 WP_003407562.1.66013 WP_003407562.1.6606 WP_003407562.1.66089 WP_003407562.1.66149 WP_003407562.1.66151 WP_003407562.1.66229 WP_003407562.1.66276 WP_003407562.1.66293 WP_003407562.1.66297 WP_003407562.1.66323 WP_003407562.1.66325 WP_003407562.1.6633 WP_003407562.1.66334 WP_003407562.1.66355 WP_003407562.1.66367 WP_003407562.1.66394 WP_003407562.1.66396 WP_003407562.1.66451 WP_003407562.1.66455 WP_003407562.1.66457 WP_003407562.1.66460 WP_003407562.1.66464 WP_003407562.1.66466 WP_003407562.1.66487 WP_003407562.1.66504 WP_003407562.1.66544 WP_003407562.1.66558 WP_003407562.1.66580 WP_003407562.1.66582 WP_003407562.1.66612 WP_003407562.1.66615 WP_003407562.1.66617 WP_003407562.1.66635 WP_003407562.1.66656 WP_003407562.1.66663 WP_003407562.1.66675 WP_003407562.1.66718 WP_003407562.1.66762 WP_003407562.1.66776 WP_003407562.1.66808 WP_003407562.1.66817 WP_003407562.1.66819 WP_003407562.1.66826 WP_003407562.1.66830 WP_003407562.1.66842 WP_003407562.1.66868 WP_003407562.1.66878 WP_003407562.1.66880 WP_003407562.1.66893 WP_003407562.1.66961 WP_003407562.1.67005 WP_003407562.1.6704 WP_003407562.1.67044 WP_003407562.1.67061 WP_003407562.1.67098 WP_003407562.1.67146 WP_003407562.1.67170 WP_003407562.1.67197 WP_003407562.1.67198 WP_003407562.1.6720 WP_003407562.1.67207 WP_003407562.1.67218 WP_003407562.1.67220 WP_003407562.1.67225 WP_003407562.1.67231 WP_003407562.1.6724 WP_003407562.1.67257 WP_003407562.1.67307 WP_003407562.1.67324 WP_003407562.1.67332 WP_003407562.1.67346 WP_003407562.1.67354 WP_003407562.1.67360 WP_003407562.1.67381 WP_003407562.1.67396 WP_003407562.1.67417 WP_003407562.1.67422 WP_003407562.1.67453 WP_003407562.1.67459 WP_003407562.1.6746 WP_003407562.1.67473 WP_003407562.1.67481 WP_003407562.1.67482 WP_003407562.1.67496 WP_003407562.1.67499 WP_003407562.1.67516 WP_003407562.1.67523 WP_003407562.1.67536 WP_003407562.1.67575 WP_003407562.1.67587 WP_003407562.1.67598 WP_003407562.1.67600 WP_003407562.1.67602 WP_003407562.1.67630 WP_003407562.1.67679 WP_003407562.1.67692 WP_003407562.1.67744 WP_003407562.1.6775 WP_003407562.1.67750 WP_003407562.1.6777 WP_003407562.1.67809 WP_003407562.1.67816 WP_003407562.1.67844 WP_003407562.1.67848 WP_003407562.1.67870 WP_003407562.1.67888 WP_003407562.1.67915 WP_003407562.1.67945 WP_003407562.1.67949 WP_003407562.1.67980 WP_003407562.1.67982 WP_003407562.1.68022 WP_003407562.1.68029 WP_003407562.1.68037 WP_003407562.1.68038 WP_003407562.1.68045 WP_003407562.1.68057 WP_003407562.1.68083 WP_003407562.1.68088 WP_003407562.1.68106 WP_003407562.1.68110 WP_003407562.1.68164 WP_003407562.1.68169 WP_003407562.1.68193 WP_003407562.1.68212 WP_003407562.1.68227 WP_003407562.1.68243 WP_003407562.1.6825 WP_003407562.1.68297 WP_003407562.1.68309 WP_003407562.1.68325 WP_003407562.1.68329 WP_003407562.1.68340 WP_003407562.1.68384 WP_003407562.1.68388 WP_003407562.1.68429 WP_003407562.1.6843 WP_003407562.1.68433 WP_003407562.1.68444 WP_003407562.1.68465 WP_003407562.1.68484 WP_003407562.1.68518 WP_003407562.1.68569 WP_003407562.1.68576 WP_003407562.1.68580 WP_003407562.1.68586 WP_003407562.1.68623 WP_003407562.1.68624 WP_003407562.1.68637 WP_003407562.1.68646 WP_003407562.1.68667 WP_003407562.1.68669 WP_003407562.1.68672 WP_003407562.1.68684 WP_003407562.1.68704 WP_003407562.1.68708 WP_003407562.1.6872 WP_003407562.1.68734 WP_003407562.1.68748 WP_003407562.1.68754 WP_003407562.1.6876 WP_003407562.1.68761 WP_003407562.1.68763 WP_003407562.1.68766 WP_003407562.1.68774 WP_003407562.1.68796 WP_003407562.1.68824 WP_003407562.1.68832 WP_003407562.1.68833 WP_003407562.1.68841 WP_003407562.1.68859 WP_003407562.1.68876 WP_003407562.1.68906 WP_003407562.1.68916 WP_003407562.1.68923 WP_003407562.1.68945 WP_003407562.1.6896 WP_003407562.1.68981 WP_003407562.1.68984 WP_003407562.1.68997 WP_003407562.1.69008 WP_003407562.1.69076 WP_003407562.1.69079 WP_003407562.1.6908 WP_003407562.1.69082 WP_003407562.1.69178 WP_003407562.1.69181 WP_003407562.1.69208 WP_003407562.1.69231 WP_003407562.1.69256 WP_003407562.1.69311 WP_003407562.1.69315 WP_003407562.1.69322 WP_003407562.1.69342 WP_003407562.1.6935 WP_003407562.1.6936 WP_003407562.1.69369 WP_003407562.1.69374 WP_003407562.1.69398 WP_003407562.1.69401 WP_003407562.1.69426 WP_003407562.1.69427 WP_003407562.1.69429 WP_003407562.1.6949 WP_003407562.1.6951 WP_003407562.1.69511 WP_003407562.1.69526 WP_003407562.1.69528 WP_003407562.1.69547 WP_003407562.1.69573 WP_003407562.1.69581 WP_003407562.1.6960 WP_003407562.1.69617 WP_003407562.1.69634 WP_003407562.1.69647 WP_003407562.1.69659 WP_003407562.1.69673 WP_003407562.1.69682 WP_003407562.1.69684 WP_003407562.1.69686 WP_003407562.1.69707 WP_003407562.1.69709 WP_003407562.1.69723 WP_003407562.1.69736 WP_003407562.1.69778 WP_003407562.1.69800 WP_003407562.1.69802 WP_003407562.1.69845 WP_003407562.1.69870 WP_003407562.1.69873 WP_003407562.1.69898 WP_003407562.1.69913 WP_003407562.1.69925 WP_003407562.1.69931 WP_003407562.1.69938 WP_003407562.1.69955 WP_003407562.1.69957 WP_003407562.1.69981 WP_003407562.1.69990 WP_003407562.1.70 WP_003407562.1.70000 WP_003407562.1.70017 WP_003407562.1.70032 WP_003407562.1.70055 WP_003407562.1.70062 WP_003407562.1.70072 WP_003407562.1.70131 WP_003407562.1.70132 WP_003407562.1.7022 WP_003407562.1.70227 WP_003407562.1.70255 WP_003407562.1.70271 WP_003407562.1.70274 WP_003407562.1.7029 WP_003407562.1.70325 WP_003407562.1.70328 WP_003407562.1.70356 WP_003407562.1.70364 WP_003407562.1.70368 WP_003407562.1.70369 WP_003407562.1.70422 WP_003407562.1.70435 WP_003407562.1.70444 WP_003407562.1.70463 WP_003407562.1.70471 WP_003407562.1.70480 WP_003407562.1.70494 WP_003407562.1.70498 WP_003407562.1.70505 WP_003407562.1.70525 WP_003407562.1.70573 WP_003407562.1.70577 WP_003407562.1.70610 WP_003407562.1.70618 WP_003407562.1.70622 WP_003407562.1.70626 WP_003407562.1.70668 WP_003407562.1.70699 WP_003407562.1.70704 WP_003407562.1.70729 WP_003407562.1.70757 WP_003407562.1.70782 WP_003407562.1.70796 WP_003407562.1.70830 WP_003407562.1.70834 WP_003407562.1.7084 WP_003407562.1.70840 WP_003407562.1.70864 WP_003407562.1.70871 WP_003407562.1.70915 WP_003407562.1.70955 WP_003407562.1.70958 WP_003407562.1.70964 WP_003407562.1.70976 WP_003407562.1.71015 WP_003407562.1.71026 WP_003407562.1.71063 WP_003407562.1.71076 WP_003407562.1.71083 WP_003407562.1.71118 WP_003407562.1.71128 WP_003407562.1.7113 WP_003407562.1.71187 WP_003407562.1.71191 WP_003407562.1.71255 WP_003407562.1.71258 WP_003407562.1.71259 WP_003407562.1.71289 WP_003407562.1.71326 WP_003407562.1.71329 WP_003407562.1.71331 WP_003407562.1.71344 WP_003407562.1.71390 WP_003407562.1.71399 WP_003407562.1.71414 WP_003407562.1.71440 WP_003407562.1.71457 WP_003407562.1.7146 WP_003407562.1.71464 WP_003407562.1.71490 WP_003407562.1.71492 WP_003407562.1.71509 WP_003407562.1.71516 WP_003407562.1.71517 WP_003407562.1.71527 WP_003407562.1.71532 WP_003407562.1.71545 WP_003407562.1.71546 WP_003407562.1.71569 WP_003407562.1.71604 WP_003407562.1.71621 WP_003407562.1.71630 WP_003407562.1.71638 WP_003407562.1.71654 WP_003407562.1.71664 WP_003407562.1.71665 WP_003407562.1.71683 WP_003407562.1.71701 WP_003407562.1.71718 WP_003407562.1.71731 WP_003407562.1.71778 WP_003407562.1.71781 WP_003407562.1.71803 WP_003407562.1.71820 WP_003407562.1.71847 WP_003407562.1.7185 WP_003407562.1.71851 WP_003407562.1.71871 WP_003407562.1.71909 WP_003407562.1.71957 WP_003407562.1.71970 WP_003407562.1.72047 WP_003407562.1.72061 WP_003407562.1.72062 WP_003407562.1.72072 WP_003407562.1.72111 WP_003407562.1.72122 WP_003407562.1.72128 WP_003407562.1.72143 WP_003407562.1.7216 WP_003407562.1.72168 WP_003407562.1.72179 WP_003407562.1.72209 WP_003407562.1.72218 WP_003407562.1.72219 WP_003407562.1.72227 WP_003407562.1.7224 WP_003407562.1.72268 WP_003407562.1.72332 WP_003407562.1.72380 WP_003407562.1.72401 WP_003407562.1.72405 WP_003407562.1.72420 WP_003407562.1.72441 WP_003407562.1.72451 WP_003407562.1.72452 WP_003407562.1.72457 WP_003407562.1.72459 WP_003407562.1.72460 WP_003407562.1.72466 WP_003407562.1.72487 WP_003407562.1.72488 WP_003407562.1.72492 WP_003407562.1.72506 WP_003407562.1.72543 WP_003407562.1.7256 WP_003407562.1.72576 WP_003407562.1.72578 WP_003407562.1.72585 WP_003407562.1.72591 WP_003407562.1.72592 WP_003407562.1.72640 WP_003407562.1.7266 WP_003407562.1.72661 WP_003407562.1.72684 WP_003407562.1.72739 WP_003407562.1.72744 WP_003407562.1.72755 WP_003407562.1.72759 WP_003407562.1.72784 WP_003407562.1.72792 WP_003407562.1.72826 WP_003407562.1.72831 WP_003407562.1.72852 WP_003407562.1.72853 WP_003407562.1.72879 WP_003407562.1.72880 WP_003407562.1.72938 WP_003407562.1.72954 WP_003407562.1.72957 WP_003407562.1.72959 WP_003407562.1.72973 WP_003407562.1.7298 WP_003407562.1.72982 WP_003407562.1.72988 WP_003407562.1.72993 WP_003407562.1.73006 WP_003407562.1.73013 WP_003407562.1.73025 WP_003407562.1.73028 WP_003407562.1.73042 WP_003407562.1.73045 WP_003407562.1.73092 WP_003407562.1.73118 WP_003407562.1.7312 WP_003407562.1.73127 WP_003407562.1.73134 WP_003407562.1.73150 WP_003407562.1.73154 WP_003407562.1.73163 WP_003407562.1.73182 WP_003407562.1.73205 WP_003407562.1.7321 WP_003407562.1.73310 WP_003407562.1.73315 WP_003407562.1.73365 WP_003407562.1.73391 WP_003407562.1.73404 WP_003407562.1.73424 WP_003407562.1.73436 WP_003407562.1.73445 WP_003407562.1.73453 WP_003407562.1.73465 WP_003407562.1.73466 WP_003407562.1.73470 WP_003407562.1.73471 WP_003407562.1.73478 WP_003407562.1.73482 WP_003407562.1.73507 WP_003407562.1.73532 WP_003407562.1.73550 WP_003407562.1.73564 WP_003407562.1.73623 WP_003407562.1.73629 WP_003407562.1.73644 WP_003407562.1.7366 WP_003407562.1.73661 WP_003407562.1.7368 WP_003407562.1.73688 WP_003407562.1.73723 WP_003407562.1.73744 WP_003407562.1.73750 WP_003407562.1.73760 WP_003407562.1.73774 WP_003407562.1.7379 WP_003407562.1.73813 WP_003407562.1.73840 WP_003407562.1.73876 WP_003407562.1.7389 WP_003407562.1.73986 WP_003407562.1.74016 WP_003407562.1.74039 WP_003407562.1.74083 WP_003407562.1.74101 WP_003407562.1.74107 WP_003407562.1.74120 WP_003407562.1.74129 WP_003407562.1.74144 WP_003407562.1.7417 WP_003407562.1.74190 WP_003407562.1.74210 WP_003407562.1.7423 WP_003407562.1.74259 WP_003407562.1.74262 WP_003407562.1.74269 WP_003407562.1.74282 WP_003407562.1.74291 WP_003407562.1.74296 WP_003407562.1.74304 WP_003407562.1.7432 WP_003407562.1.74347 WP_003407562.1.7436 WP_003407562.1.74378 WP_003407562.1.74382 WP_003407562.1.74395 WP_003407562.1.74400 WP_003407562.1.74401 WP_003407562.1.74432 WP_003407562.1.74442 WP_003407562.1.74477 WP_003407562.1.74487 WP_003407562.1.74499 WP_003407562.1.74504 WP_003407562.1.74511 WP_003407562.1.74523 WP_003407562.1.74525 WP_003407562.1.74551 WP_003407562.1.74555 WP_003407562.1.74628 WP_003407562.1.74641 WP_003407562.1.74660 WP_003407562.1.74683 WP_003407562.1.7469 WP_003407562.1.74725 WP_003407562.1.74760 WP_003407562.1.74786 WP_003407562.1.74809 WP_003407562.1.74820 WP_003407562.1.74870 WP_003407562.1.74881 WP_003407562.1.74888 WP_003407562.1.74952 WP_003407562.1.7496 WP_003407562.1.74988 WP_003407562.1.75043 WP_003407562.1.75045 WP_003407562.1.75055 WP_003407562.1.75078 WP_003407562.1.75081 WP_003407562.1.75120 WP_003407562.1.75163 WP_003407562.1.75200 WP_003407562.1.75202 WP_003407562.1.75234 WP_003407562.1.75239 WP_003407562.1.75250 WP_003407562.1.75263 WP_003407562.1.75281 WP_003407562.1.75342 WP_003407562.1.7535 WP_003407562.1.75376 WP_003407562.1.75391 WP_003407562.1.75395 WP_003407562.1.75441 WP_003407562.1.75510 WP_003407562.1.75581 WP_003407562.1.75598 WP_003407562.1.75635 WP_003407562.1.75645 WP_003407562.1.75665 WP_003407562.1.75671 WP_003407562.1.75741 WP_003407562.1.75749 WP_003407562.1.75772 WP_003407562.1.75774 WP_003407562.1.75811 WP_003407562.1.75833 WP_003407562.1.7585 WP_003407562.1.75864 WP_003407562.1.75868 WP_003407562.1.75878 WP_003407562.1.75927 WP_003407562.1.75946 WP_003407562.1.75968 WP_003407562.1.75974 WP_003407562.1.76007 WP_003407562.1.76016 WP_003407562.1.76032 WP_003407562.1.76037 WP_003407562.1.7604 WP_003407562.1.76045 WP_003407562.1.76052 WP_003407562.1.76058 WP_003407562.1.76064 WP_003407562.1.76110 WP_003407562.1.76126 WP_003407562.1.76133 WP_003407562.1.76138 WP_003407562.1.76157 WP_003407562.1.76172 WP_003407562.1.76177 WP_003407562.1.76209 WP_003407562.1.76239 WP_003407562.1.76272 WP_003407562.1.76277 WP_003407562.1.76280 WP_003407562.1.76281 WP_003407562.1.76291 WP_003407562.1.76297 WP_003407562.1.76360 WP_003407562.1.76379 WP_003407562.1.76403 WP_003407562.1.76413 WP_003407562.1.76414 WP_003407562.1.76427 WP_003407562.1.76436 WP_003407562.1.76442 WP_003407562.1.76443 WP_003407562.1.76456 WP_003407562.1.76521 WP_003407562.1.76533 WP_003407562.1.76616 WP_003407562.1.76625 WP_003407562.1.76629 WP_003407562.1.76635 WP_003407562.1.76638 WP_003407562.1.76639 WP_003407562.1.76640 WP_003407562.1.76644 WP_003407562.1.76677 WP_003407562.1.76678 WP_003407562.1.76679 WP_003407562.1.76734 WP_003407562.1.76744 WP_003407562.1.76750 WP_003407562.1.76754 WP_003407562.1.76757 WP_003407562.1.76781 WP_003407562.1.76818 WP_003407562.1.76824 WP_003407562.1.76835 WP_003407562.1.76873 WP_003407562.1.76881 WP_003407562.1.76888 WP_003407562.1.76900 WP_003407562.1.76947 WP_003407562.1.76954 WP_003407562.1.76955 WP_003407562.1.76963 WP_003407562.1.76976 WP_003407562.1.770 WP_003407562.1.77000 WP_003407562.1.77008 WP_003407562.1.77021 WP_003407562.1.77056 WP_003407562.1.77065 WP_003407562.1.77075 WP_003407562.1.77093 WP_003407562.1.77115 WP_003407562.1.77118 WP_003407562.1.77125 WP_003407562.1.77141 WP_003407562.1.77142 WP_003407562.1.77166 WP_003407562.1.77250 WP_003407562.1.77252 WP_003407562.1.77260 WP_003407562.1.77266 WP_003407562.1.77280 WP_003407562.1.77285 WP_003407562.1.77312 WP_003407562.1.77348 WP_003407562.1.77351 WP_003407562.1.77352 WP_003407562.1.77361 WP_003407562.1.774 WP_003407562.1.7740 WP_003407562.1.77404 WP_003407562.1.77425 WP_003407562.1.77463 WP_003407562.1.77474 WP_003407562.1.7748 WP_003407562.1.77484 WP_003407562.1.77491 WP_003407562.1.77499 WP_003407562.1.77510 WP_003407562.1.77530 WP_003407562.1.77554 WP_003407562.1.77559 WP_003407562.1.77599 WP_003407562.1.77605 WP_003407562.1.7762 WP_003407562.1.77627 WP_003407562.1.77649 WP_003407562.1.77654 WP_003407562.1.7766 WP_003407562.1.77667 WP_003407562.1.77704 WP_003407562.1.77706 WP_003407562.1.77726 WP_003407562.1.77774 WP_003407562.1.7778 WP_003407562.1.77790 WP_003407562.1.77809 WP_003407562.1.77820 WP_003407562.1.77843 WP_003407562.1.77855 WP_003407562.1.77865 WP_003407562.1.77868 WP_003407562.1.77879 WP_003407562.1.77890 WP_003407562.1.77909 WP_003407562.1.77911 WP_003407562.1.77931 WP_003407562.1.77984 WP_003407562.1.78020 WP_003407562.1.78024 WP_003407562.1.78075 WP_003407562.1.78084 WP_003407562.1.78086 WP_003407562.1.7809 WP_003407562.1.78098 WP_003407562.1.78105 WP_003407562.1.78113 WP_003407562.1.78136 WP_003407562.1.78162 WP_003407562.1.7817 WP_003407562.1.78200 WP_003407562.1.78216 WP_003407562.1.78236 WP_003407562.1.78238 WP_003407562.1.78322 WP_003407562.1.78338 WP_003407562.1.7836 WP_003407562.1.78360 WP_003407562.1.78386 WP_003407562.1.78429 WP_003407562.1.78435 WP_003407562.1.7844 WP_003407562.1.78459 WP_003407562.1.78488 WP_003407562.1.7849 WP_003407562.1.78499 WP_003407562.1.785 WP_003407562.1.78516 WP_003407562.1.78524 WP_003407562.1.78526 WP_003407562.1.78538 WP_003407562.1.78544 WP_003407562.1.78545 WP_003407562.1.78547 WP_003407562.1.78574 WP_003407562.1.78580 WP_003407562.1.7860 WP_003407562.1.78620 WP_003407562.1.78646 WP_003407562.1.78648 WP_003407562.1.78649 WP_003407562.1.78655 WP_003407562.1.78657 WP_003407562.1.78659 WP_003407562.1.7869 WP_003407562.1.78692 WP_003407562.1.78760 WP_003407562.1.78766 WP_003407562.1.78776 WP_003407562.1.78778 WP_003407562.1.78784 WP_003407562.1.78788 WP_003407562.1.78790 WP_003407562.1.78793 WP_003407562.1.78848 WP_003407562.1.78860 WP_003407562.1.7887 WP_003407562.1.78884 WP_003407562.1.78932 WP_003407562.1.78969 WP_003407562.1.78977 WP_003407562.1.78980 WP_003407562.1.79005 WP_003407562.1.79016 WP_003407562.1.79033 WP_003407562.1.79064 WP_003407562.1.79066 WP_003407562.1.79068 WP_003407562.1.79077 WP_003407562.1.79095 WP_003407562.1.79112 WP_003407562.1.79122 WP_003407562.1.79145 WP_003407562.1.79152 WP_003407562.1.79163 WP_003407562.1.79182 WP_003407562.1.79198 WP_003407562.1.79213 WP_003407562.1.79218 WP_003407562.1.79268 WP_003407562.1.79273 WP_003407562.1.79278 WP_003407562.1.79290 WP_003407562.1.79319 WP_003407562.1.79325 WP_003407562.1.79326 WP_003407562.1.7933 WP_003407562.1.79330 WP_003407562.1.79339 WP_003407562.1.79394 WP_003407562.1.79399 WP_003407562.1.79413 WP_003407562.1.79422 WP_003407562.1.79445 WP_003407562.1.79447 WP_003407562.1.79455 WP_003407562.1.79471 WP_003407562.1.79480 WP_003407562.1.79482 WP_003407562.1.79488 WP_003407562.1.79500 WP_003407562.1.79502 WP_003407562.1.79508 WP_003407562.1.79514 WP_003407562.1.79561 WP_003407562.1.79565 WP_003407562.1.79578 WP_003407562.1.79588 WP_003407562.1.79598 WP_003407562.1.79615 WP_003407562.1.79684 WP_003407562.1.79698 WP_003407562.1.797 WP_003407562.1.79744 WP_003407562.1.79784 WP_003407562.1.79802 WP_003407562.1.79806 WP_003407562.1.79819 WP_003407562.1.79826 WP_003407562.1.79828 WP_003407562.1.79851 WP_003407562.1.79853 WP_003407562.1.79863 WP_003407562.1.79881 WP_003407562.1.79885 WP_003407562.1.79898 WP_003407562.1.7990 WP_003407562.1.79900 WP_003407562.1.79913 WP_003407562.1.79918 WP_003407562.1.79947 WP_003407562.1.79948 WP_003407562.1.7995 WP_003407562.1.7997 WP_003407562.1.80004 WP_003407562.1.80015 WP_003407562.1.80022 WP_003407562.1.80030 WP_003407562.1.80054 WP_003407562.1.80084 WP_003407562.1.80099 WP_003407562.1.80129 WP_003407562.1.80177 WP_003407562.1.80234 WP_003407562.1.8026 WP_003407562.1.80275 WP_003407562.1.8029 WP_003407562.1.80299 WP_003407562.1.80300 WP_003407562.1.80304 WP_003407562.1.80326 WP_003407562.1.80351 WP_003407562.1.8037 WP_003407562.1.80370 WP_003407562.1.80387 WP_003407562.1.80399 WP_003407562.1.8044 WP_003407562.1.80451 WP_003407562.1.80458 WP_003407562.1.80461 WP_003407562.1.80490 WP_003407562.1.80503 WP_003407562.1.80507 WP_003407562.1.80552 WP_003407562.1.80576 WP_003407562.1.80588 WP_003407562.1.80599 WP_003407562.1.8060 WP_003407562.1.80624 WP_003407562.1.80636 WP_003407562.1.80669 WP_003407562.1.80673 WP_003407562.1.80711 WP_003407562.1.80714 WP_003407562.1.80743 WP_003407562.1.80784 WP_003407562.1.80815 WP_003407562.1.80853 WP_003407562.1.80918 WP_003407562.1.8093 WP_003407562.1.80967 WP_003407562.1.8097 WP_003407562.1.80988 WP_003407562.1.81007 WP_003407562.1.81013 WP_003407562.1.8105 WP_003407562.1.81059 WP_003407562.1.81063 WP_003407562.1.81066 WP_003407562.1.81075 WP_003407562.1.81091 WP_003407562.1.81119 WP_003407562.1.81125 WP_003407562.1.81136 WP_003407562.1.8114 WP_003407562.1.81189 WP_003407562.1.81192 WP_003407562.1.812 WP_003407562.1.81230 WP_003407562.1.81249 WP_003407562.1.81250 WP_003407562.1.81264 WP_003407562.1.8128 WP_003407562.1.81287 WP_003407562.1.81297 WP_003407562.1.8138 WP_003407562.1.81407 WP_003407562.1.8143 WP_003407562.1.81439 WP_003407562.1.81465 WP_003407562.1.81505 WP_003407562.1.81529 WP_003407562.1.81538 WP_003407562.1.81541 WP_003407562.1.81560 WP_003407562.1.81561 WP_003407562.1.81567 WP_003407562.1.81583 WP_003407562.1.81686 WP_003407562.1.81712 WP_003407562.1.81720 WP_003407562.1.81731 WP_003407562.1.81774 WP_003407562.1.81788 WP_003407562.1.81809 WP_003407562.1.81820 WP_003407562.1.81850 WP_003407562.1.81883 WP_003407562.1.81891 WP_003407562.1.81911 WP_003407562.1.81918 WP_003407562.1.82011 WP_003407562.1.82048 WP_003407562.1.82069 WP_003407562.1.82071 WP_003407562.1.82108 WP_003407562.1.82136 WP_003407562.1.82142 WP_003407562.1.8215 WP_003407562.1.82158 WP_003407562.1.8217 WP_003407562.1.82209 WP_003407562.1.82210 WP_003407562.1.82228 WP_003407562.1.82236 WP_003407562.1.82251 WP_003407562.1.82271 WP_003407562.1.82305 WP_003407562.1.82307 WP_003407562.1.82309 WP_003407562.1.82317 WP_003407562.1.8232 WP_003407562.1.82346 WP_003407562.1.82374 WP_003407562.1.82385 WP_003407562.1.82429 WP_003407562.1.82460 WP_003407562.1.82462 WP_003407562.1.82483 WP_003407562.1.82494 WP_003407562.1.82531 WP_003407562.1.82546 WP_003407562.1.82547 WP_003407562.1.82549 WP_003407562.1.82577 WP_003407562.1.82592 WP_003407562.1.82597 WP_003407562.1.82598 WP_003407562.1.82625 WP_003407562.1.82642 WP_003407562.1.82651 WP_003407562.1.82653 WP_003407562.1.82681 WP_003407562.1.82685 WP_003407562.1.8271 WP_003407562.1.82712 WP_003407562.1.8273 WP_003407562.1.82743 WP_003407562.1.82757 WP_003407562.1.82774 WP_003407562.1.82803 WP_003407562.1.82836 WP_003407562.1.82860 WP_003407562.1.82871 WP_003407562.1.82892 WP_003407562.1.82935 WP_003407562.1.82957 WP_003407562.1.82973 WP_003407562.1.82981 WP_003407562.1.82983 WP_003407562.1.83004 WP_003407562.1.83009 WP_003407562.1.83044 WP_003407562.1.83074 WP_003407562.1.83110 WP_003407562.1.83146 WP_003407562.1.83149 WP_003407562.1.83159 WP_003407562.1.8317 WP_003407562.1.83173 WP_003407562.1.83181 WP_003407562.1.83182 WP_003407562.1.83191 WP_003407562.1.83197 WP_003407562.1.83212 WP_003407562.1.8326 WP_003407562.1.83262 WP_003407562.1.83268 WP_003407562.1.83273 WP_003407562.1.83309 WP_003407562.1.83332 WP_003407562.1.83334 WP_003407562.1.83341 WP_003407562.1.83349 WP_003407562.1.8335 WP_003407562.1.83353 WP_003407562.1.83367 WP_003407562.1.83380 WP_003407562.1.83381 WP_003407562.1.83389 WP_003407562.1.83408 WP_003407562.1.83409 WP_003407562.1.83435 WP_003407562.1.83470 WP_003407562.1.83524 WP_003407562.1.83526 WP_003407562.1.8358 WP_003407562.1.83589 WP_003407562.1.83601 WP_003407562.1.83611 WP_003407562.1.83638 WP_003407562.1.83648 WP_003407562.1.83656 WP_003407562.1.83667 WP_003407562.1.83689 WP_003407562.1.83692 WP_003407562.1.83704 WP_003407562.1.83705 WP_003407562.1.83766 WP_003407562.1.83793 WP_003407562.1.83794 WP_003407562.1.83802 WP_003407562.1.83805 WP_003407562.1.83839 WP_003407562.1.83842 WP_003407562.1.83850 WP_003407562.1.83884 WP_003407562.1.83920 WP_003407562.1.83929 WP_003407562.1.83930 WP_003407562.1.83975 WP_003407562.1.83991 WP_003407562.1.8400 WP_003407562.1.84027 WP_003407562.1.8404 WP_003407562.1.84057 WP_003407562.1.84070 WP_003407562.1.8409 WP_003407562.1.84112 WP_003407562.1.84146 WP_003407562.1.8415 WP_003407562.1.84176 WP_003407562.1.84186 WP_003407562.1.84192 WP_003407562.1.84228 WP_003407562.1.8424 WP_003407562.1.84244 WP_003407562.1.84259 WP_003407562.1.8426 WP_003407562.1.84277 WP_003407562.1.84287 WP_003407562.1.8434 WP_003407562.1.84388 WP_003407562.1.84408 WP_003407562.1.84409 WP_003407562.1.84438 WP_003407562.1.84460 WP_003407562.1.84488 WP_003407562.1.84504 WP_003407562.1.84620 WP_003407562.1.84623 WP_003407562.1.84641 WP_003407562.1.84655 WP_003407562.1.84666 WP_003407562.1.84670 WP_003407562.1.84739 WP_003407562.1.84748 WP_003407562.1.84766 WP_003407562.1.84772 WP_003407562.1.84774 WP_003407562.1.848 WP_003407562.1.84812 WP_003407562.1.84836 WP_003407562.1.84839 WP_003407562.1.84846 WP_003407562.1.84873 WP_003407562.1.84911 WP_003407562.1.84938 WP_003407562.1.84968 WP_003407562.1.84973 WP_003407562.1.84981 WP_003407562.1.84985 WP_003407562.1.8503 WP_003407562.1.85038 WP_003407562.1.85041 WP_003407562.1.85043 WP_003407562.1.8505 WP_003407562.1.85074 WP_003407562.1.8512 WP_003407562.1.85148 WP_003407562.1.8518 WP_003407562.1.8522 WP_003407562.1.85242 WP_003407562.1.85276 WP_003407562.1.85281 WP_003407562.1.85284 WP_003407562.1.85314 WP_003407562.1.85319 WP_003407562.1.85330 WP_003407562.1.85341 WP_003407562.1.85346 WP_003407562.1.8535 WP_003407562.1.85363 WP_003407562.1.85371 WP_003407562.1.85377 WP_003407562.1.85387 WP_003407562.1.85399 WP_003407562.1.85458 WP_003407562.1.8546 WP_003407562.1.85464 WP_003407562.1.85478 WP_003407562.1.85480 WP_003407562.1.85488 WP_003407562.1.85495 WP_003407562.1.85551 WP_003407562.1.85557 WP_003407562.1.85577 WP_003407562.1.85597 WP_003407562.1.85599 WP_003407562.1.85610 WP_003407562.1.8563 WP_003407562.1.85648 WP_003407562.1.85679 WP_003407562.1.85704 WP_003407562.1.85717 WP_003407562.1.85737 WP_003407562.1.85763 WP_003407562.1.85808 WP_003407562.1.85820 WP_003407562.1.85823 WP_003407562.1.85832 WP_003407562.1.8586 WP_003407562.1.85872 WP_003407562.1.85894 WP_003407562.1.85913 WP_003407562.1.85953 WP_003407562.1.85986 WP_003407562.1.86000 WP_003407562.1.86024 WP_003407562.1.86025 WP_003407562.1.86032 WP_003407562.1.86048 WP_003407562.1.86052 WP_003407562.1.86067 WP_003407562.1.86103 WP_003407562.1.86122 WP_003407562.1.86124 WP_003407562.1.86160 WP_003407562.1.86164 WP_003407562.1.86168 WP_003407562.1.86190 WP_003407562.1.86204 WP_003407562.1.86208 WP_003407562.1.86235 WP_003407562.1.86249 WP_003407562.1.86260 WP_003407562.1.86290 WP_003407562.1.863 WP_003407562.1.86327 WP_003407562.1.86334 WP_003407562.1.86337 WP_003407562.1.86368 WP_003407562.1.86377 WP_003407562.1.86425 WP_003407562.1.86459 WP_003407562.1.8649 WP_003407562.1.86499 WP_003407562.1.86520 WP_003407562.1.86561 WP_003407562.1.86568 WP_003407562.1.86575 WP_003407562.1.86584 WP_003407562.1.86605 WP_003407562.1.86626 WP_003407562.1.86648 WP_003407562.1.8666 WP_003407562.1.86684 WP_003407562.1.86696 WP_003407562.1.86705 WP_003407562.1.86718 WP_003407562.1.86725 WP_003407562.1.86757 WP_003407562.1.86766 WP_003407562.1.86801 WP_003407562.1.86814 WP_003407562.1.86820 WP_003407562.1.86825 WP_003407562.1.86834 WP_003407562.1.8685 WP_003407562.1.86851 WP_003407562.1.86855 WP_003407562.1.86867 WP_003407562.1.86883 WP_003407562.1.8689 WP_003407562.1.86892 WP_003407562.1.86933 WP_003407562.1.86941 WP_003407562.1.86950 WP_003407562.1.86962 WP_003407562.1.86963 WP_003407562.1.86979 WP_003407562.1.8700 WP_003407562.1.87001 WP_003407562.1.87002 WP_003407562.1.87031 WP_003407562.1.87116 WP_003407562.1.87117 WP_003407562.1.8714 WP_003407562.1.87162 WP_003407562.1.87178 WP_003407562.1.87191 WP_003407562.1.87201 WP_003407562.1.87209 WP_003407562.1.87240 WP_003407562.1.87266 WP_003407562.1.87273 WP_003407562.1.87275 WP_003407562.1.8733 WP_003407562.1.87345 WP_003407562.1.87369 WP_003407562.1.8737 WP_003407562.1.87401 WP_003407562.1.87404 WP_003407562.1.87406 WP_003407562.1.87409 WP_003407562.1.87444 WP_003407562.1.87446 WP_003407562.1.87459 WP_003407562.1.87472 WP_003407562.1.87489 WP_003407562.1.87494 WP_003407562.1.87496 WP_003407562.1.87582 WP_003407562.1.87588 WP_003407562.1.87617 WP_003407562.1.87619 WP_003407562.1.87620 WP_003407562.1.87634 WP_003407562.1.87643 WP_003407562.1.8765 WP_003407562.1.87650 WP_003407562.1.87654 WP_003407562.1.87658 WP_003407562.1.87665 WP_003407562.1.87676 WP_003407562.1.87677 WP_003407562.1.87684 WP_003407562.1.87692 WP_003407562.1.87707 WP_003407562.1.87732 WP_003407562.1.87784 WP_003407562.1.87796 WP_003407562.1.87809 WP_003407562.1.87817 WP_003407562.1.87827 WP_003407562.1.87831 WP_003407562.1.87835 WP_003407562.1.87837 WP_003407562.1.87866 WP_003407562.1.8789 WP_003407562.1.87911 WP_003407562.1.87924 WP_003407562.1.87951 WP_003407562.1.87955 WP_003407562.1.87956 WP_003407562.1.87991 WP_003407562.1.88 WP_003407562.1.88002 WP_003407562.1.88037 WP_003407562.1.88039 WP_003407562.1.88072 WP_003407562.1.88077 WP_003407562.1.88121 WP_003407562.1.88180 WP_003407562.1.88191 WP_003407562.1.88205 WP_003407562.1.88217 WP_003407562.1.88219 WP_003407562.1.88245 WP_003407562.1.88253 WP_003407562.1.88294 WP_003407562.1.88315 WP_003407562.1.88316 WP_003407562.1.88320 WP_003407562.1.88338 WP_003407562.1.8840 WP_003407562.1.88437 WP_003407562.1.88453 WP_003407562.1.88469 WP_003407562.1.88489 WP_003407562.1.88507 WP_003407562.1.88521 WP_003407562.1.88530 WP_003407562.1.88537 WP_003407562.1.88541 WP_003407562.1.88592 WP_003407562.1.88616 WP_003407562.1.8862 WP_003407562.1.88625 WP_003407562.1.88632 WP_003407562.1.88634 WP_003407562.1.88649 WP_003407562.1.8870 WP_003407562.1.88737 WP_003407562.1.88756 WP_003407562.1.888 WP_003407562.1.88824 WP_003407562.1.88886 WP_003407562.1.88965 WP_003407562.1.88985 WP_003407562.1.8902 WP_003407562.1.89025 WP_003407562.1.89041 WP_003407562.1.89046 WP_003407562.1.89082 WP_003407562.1.89162 WP_003407562.1.89168 WP_003407562.1.8917 WP_003407562.1.89193 WP_003407562.1.89205 WP_003407562.1.89207 WP_003407562.1.89225 WP_003407562.1.8925 WP_003407562.1.89277 WP_003407562.1.89286 WP_003407562.1.89293 WP_003407562.1.89320 WP_003407562.1.8935 WP_003407562.1.89371 WP_003407562.1.89378 WP_003407562.1.89392 WP_003407562.1.89406 WP_003407562.1.8943 WP_003407562.1.89451 WP_003407562.1.89453 WP_003407562.1.89475 WP_003407562.1.89483 WP_003407562.1.895 WP_003407562.1.89513 WP_003407562.1.89517 WP_003407562.1.89522 WP_003407562.1.8954 WP_003407562.1.89543 WP_003407562.1.89567 WP_003407562.1.8957 WP_003407562.1.89572 WP_003407562.1.89589 WP_003407562.1.89607 WP_003407562.1.89613 WP_003407562.1.89625 WP_003407562.1.89648 WP_003407562.1.8967 WP_003407562.1.89670 WP_003407562.1.89676 WP_003407562.1.89729 WP_003407562.1.89739 WP_003407562.1.89762 WP_003407562.1.8977 WP_003407562.1.89802 WP_003407562.1.89808 WP_003407562.1.8982 WP_003407562.1.89829 WP_003407562.1.89831 WP_003407562.1.89844 WP_003407562.1.89849 WP_003407562.1.8989 WP_003407562.1.89901 WP_003407562.1.89903 WP_003407562.1.89909 WP_003407562.1.8992 WP_003407562.1.89922 WP_003407562.1.89926 WP_003407562.1.89963 WP_003407562.1.89971 WP_003407562.1.8998 WP_003407562.1.89987 WP_003407562.1.900 WP_003407562.1.90048 WP_003407562.1.9007 WP_003407562.1.90080 WP_003407562.1.90130 WP_003407562.1.90134 WP_003407562.1.90137 WP_003407562.1.90157 WP_003407562.1.90184 WP_003407562.1.90199 WP_003407562.1.90231 WP_003407562.1.90245 WP_003407562.1.90308 WP_003407562.1.90322 WP_003407562.1.90328 WP_003407562.1.90372 WP_003407562.1.90439 WP_003407562.1.90481 WP_003407562.1.90499 WP_003407562.1.9050 WP_003407562.1.90527 WP_003407562.1.90550 WP_003407562.1.90560 WP_003407562.1.90612 WP_003407562.1.90640 WP_003407562.1.90672 WP_003407562.1.90687 WP_003407562.1.90691 WP_003407562.1.90711 WP_003407562.1.90722 WP_003407562.1.90744 WP_003407562.1.9075 WP_003407562.1.90756 WP_003407562.1.90767 WP_003407562.1.90771 WP_003407562.1.90785 WP_003407562.1.90788 WP_003407562.1.90800 WP_003407562.1.90810 WP_003407562.1.90816 WP_003407562.1.90819 WP_003407562.1.9082 WP_003407562.1.90831 WP_003407562.1.90884 WP_003407562.1.90899 WP_003407562.1.90906 WP_003407562.1.90958 WP_003407562.1.90976 WP_003407562.1.90977 WP_003407562.1.90987 WP_003407562.1.9102 WP_003407562.1.91026 WP_003407562.1.91032 WP_003407562.1.91043 WP_003407562.1.91053 WP_003407562.1.91082 WP_003407562.1.91106 WP_003407562.1.91112 WP_003407562.1.91151 WP_003407562.1.91157 WP_003407562.1.91167 WP_003407562.1.91169 WP_003407562.1.91192 WP_003407562.1.91201 WP_003407562.1.91207 WP_003407562.1.91208 WP_003407562.1.91211 WP_003407562.1.91214 WP_003407562.1.91230 WP_003407562.1.91244 WP_003407562.1.91251 WP_003407562.1.91260 WP_003407562.1.91265 WP_003407562.1.9128 WP_003407562.1.91284 WP_003407562.1.91294 WP_003407562.1.91303 WP_003407562.1.91322 WP_003407562.1.91352 WP_003407562.1.91386 WP_003407562.1.9139 WP_003407562.1.91398 WP_003407562.1.91411 WP_003407562.1.91430 WP_003407562.1.91483 WP_003407562.1.91496 WP_003407562.1.91507 WP_003407562.1.91508 WP_003407562.1.91576 WP_003407562.1.91589 WP_003407562.1.91694 WP_003407562.1.91695 WP_003407562.1.91713 WP_003407562.1.91716 WP_003407562.1.91717 WP_003407562.1.91728 WP_003407562.1.91743 WP_003407562.1.91759 WP_003407562.1.91784 WP_003407562.1.91785 WP_003407562.1.91786 WP_003407562.1.91802 WP_003407562.1.91822 WP_003407562.1.91828 WP_003407562.1.9189 WP_003407562.1.91896 WP_003407562.1.9190 WP_003407562.1.91915 WP_003407562.1.91931 WP_003407562.1.91937 WP_003407562.1.91944 WP_003407562.1.91953 WP_003407562.1.91957 WP_003407562.1.91976 WP_003407562.1.91978 WP_003407562.1.92021 WP_003407562.1.92083 WP_003407562.1.92127 WP_003407562.1.92144 WP_003407562.1.92150 WP_003407562.1.92153 WP_003407562.1.92190 WP_003407562.1.92192 WP_003407562.1.92200 WP_003407562.1.92220 WP_003407562.1.92221 WP_003407562.1.92222 WP_003407562.1.92273 WP_003407562.1.92289 WP_003407562.1.9229 WP_003407562.1.92294 WP_003407562.1.92317 WP_003407562.1.92334 WP_003407562.1.92338 WP_003407562.1.92345 WP_003407562.1.92356 WP_003407562.1.92364 WP_003407562.1.92380 WP_003407562.1.92416 WP_003407562.1.92428 WP_003407562.1.92447 WP_003407562.1.92456 WP_003407562.1.92467 WP_003407562.1.92471 WP_003407562.1.92490 WP_003407562.1.92508 WP_003407562.1.9251 WP_003407562.1.92511 WP_003407562.1.92523 WP_003407562.1.92527 WP_003407562.1.92536 WP_003407562.1.92592 WP_003407562.1.92603 WP_003407562.1.92606 WP_003407562.1.92610 WP_003407562.1.92613 WP_003407562.1.9263 WP_003407562.1.9265 WP_003407562.1.92650 WP_003407562.1.92660 WP_003407562.1.92677 WP_003407562.1.92685 WP_003407562.1.92689 WP_003407562.1.92690 WP_003407562.1.92706 WP_003407562.1.92714 WP_003407562.1.92736 WP_003407562.1.9274 WP_003407562.1.92752 WP_003407562.1.92760 WP_003407562.1.92777 WP_003407562.1.92803 WP_003407562.1.92833 WP_003407562.1.92856 WP_003407562.1.92881 WP_003407562.1.92892 WP_003407562.1.92907 WP_003407562.1.92908 WP_003407562.1.9291 WP_003407562.1.92917 WP_003407562.1.92996 WP_003407562.1.93006 WP_003407562.1.93008 WP_003407562.1.93009 WP_003407562.1.93015 WP_003407562.1.93043 WP_003407562.1.9307 WP_003407562.1.93083 WP_003407562.1.93097 WP_003407562.1.93137 WP_003407562.1.93192 WP_003407562.1.93199 WP_003407562.1.93203 WP_003407562.1.93212 WP_003407562.1.93234 WP_003407562.1.93245 WP_003407562.1.93257 WP_003407562.1.93265 WP_003407562.1.93297 WP_003407562.1.93320 WP_003407562.1.93328 WP_003407562.1.93337 WP_003407562.1.93343 WP_003407562.1.93349 WP_003407562.1.93363 WP_003407562.1.93377 WP_003407562.1.9338 WP_003407562.1.93407 WP_003407562.1.93417 WP_003407562.1.93419 WP_003407562.1.93426 WP_003407562.1.9344 WP_003407562.1.93443 WP_003407562.1.93447 WP_003407562.1.93470 WP_003407562.1.93483 WP_003407562.1.93487 WP_003407562.1.93495 WP_003407562.1.93499 WP_003407562.1.93516 WP_003407562.1.93536 WP_003407562.1.93544 WP_003407562.1.93555 WP_003407562.1.93560 WP_003407562.1.93564 WP_003407562.1.9357 WP_003407562.1.93573 WP_003407562.1.93576 WP_003407562.1.93588 WP_003407562.1.9363 WP_003407562.1.93645 WP_003407562.1.93649 WP_003407562.1.93659 WP_003407562.1.93677 WP_003407562.1.9368 WP_003407562.1.93689 WP_003407562.1.93693 WP_003407562.1.93698 WP_003407562.1.93706 WP_003407562.1.9371 WP_003407562.1.93792 WP_003407562.1.93823 WP_003407562.1.93871 WP_003407562.1.9388 WP_003407562.1.93894 WP_003407562.1.93903 WP_003407562.1.93907 WP_003407562.1.93913 WP_003407562.1.93946 WP_003407562.1.93950 WP_003407562.1.93953 WP_003407562.1.93954 WP_003407562.1.93988 WP_003407562.1.9407 WP_003407562.1.94143 WP_003407562.1.94154 WP_003407562.1.94184 WP_003407562.1.94204 WP_003407562.1.94205 WP_003407562.1.94226 WP_003407562.1.94231 WP_003407562.1.94256 WP_003407562.1.94261 WP_003407562.1.94281 WP_003407562.1.94292 WP_003407562.1.94297 WP_003407562.1.9431 WP_003407562.1.94326 WP_003407562.1.94339 WP_003407562.1.94392 WP_003407562.1.94416 WP_003407562.1.94421 WP_003407562.1.94456 WP_003407562.1.94470 WP_003407562.1.94480 WP_003407562.1.94495 WP_003407562.1.94511 WP_003407562.1.94512 WP_003407562.1.94525 WP_003407562.1.94528 WP_003407562.1.946 WP_003407562.1.94602 WP_003407562.1.94623 WP_003407562.1.94629 WP_003407562.1.9465 WP_003407562.1.94673 WP_003407562.1.94714 WP_003407562.1.94730 WP_003407562.1.94736 WP_003407562.1.94776 WP_003407562.1.9478 WP_003407562.1.94834 WP_003407562.1.94852 WP_003407562.1.94872 WP_003407562.1.9488 WP_003407562.1.94902 WP_003407562.1.94916 WP_003407562.1.94979 WP_003407562.1.94994 WP_003407562.1.94996 WP_003407562.1.94998 WP_003407562.1.95007 WP_003407562.1.95010 WP_003407562.1.95015 WP_003407562.1.95034 WP_003407562.1.95068 WP_003407562.1.95081 WP_003407562.1.95082 WP_003407562.1.9509 WP_003407562.1.95096 WP_003407562.1.95112 WP_003407562.1.95138 WP_003407562.1.9514 WP_003407562.1.95179 WP_003407562.1.95188 WP_003407562.1.95190 WP_003407562.1.95234 WP_003407562.1.95241 WP_003407562.1.95245 WP_003407562.1.95257 WP_003407562.1.95279 WP_003407562.1.9531 WP_003407562.1.95335 WP_003407562.1.95344 WP_003407562.1.9535 WP_003407562.1.95370 WP_003407562.1.95392 WP_003407562.1.95416 WP_003407562.1.95417 WP_003407562.1.95454 WP_003407562.1.95455 WP_003407562.1.95491 WP_003407562.1.95497 WP_003407562.1.95508 WP_003407562.1.95509 WP_003407562.1.95529 WP_003407562.1.95556 WP_003407562.1.95557 WP_003407562.1.95565 WP_003407562.1.95578 WP_003407562.1.95580 WP_003407562.1.95585 WP_003407562.1.95643 WP_003407562.1.95679 WP_003407562.1.95685 WP_003407562.1.957 WP_003407562.1.95724 WP_003407562.1.95727 WP_003407562.1.95730 WP_003407562.1.95735 WP_003407562.1.95758 WP_003407562.1.95772 WP_003407562.1.95797 WP_003407562.1.95839 WP_003407562.1.9590 WP_003407562.1.95902 WP_003407562.1.95908 WP_003407562.1.95924 WP_003407562.1.95953 WP_003407562.1.95958 WP_003407562.1.95964 WP_003407562.1.95973 WP_003407562.1.96006 WP_003407562.1.9602 WP_003407562.1.96036 WP_003407562.1.96062 WP_003407562.1.96065 WP_003407562.1.96098 WP_003407562.1.96146 WP_003407562.1.96166 WP_003407562.1.96171 WP_003407562.1.96182 WP_003407562.1.96204 WP_003407562.1.96230 WP_003407562.1.96235 WP_003407562.1.96242 WP_003407562.1.96245 WP_003407562.1.96254 WP_003407562.1.96259 WP_003407562.1.96286 WP_003407562.1.96313 WP_003407562.1.96318 WP_003407562.1.96345 WP_003407562.1.96360 WP_003407562.1.96373 WP_003407562.1.96456 WP_003407562.1.96486 WP_003407562.1.96560 WP_003407562.1.96569 WP_003407562.1.96573 WP_003407562.1.96575 WP_003407562.1.96576 WP_003407562.1.96611 WP_003407562.1.96621 WP_003407562.1.9667 WP_003407562.1.96681 WP_003407562.1.96726 WP_003407562.1.96733 WP_003407562.1.96742 WP_003407562.1.96754 WP_003407562.1.9678 WP_003407562.1.96832 WP_003407562.1.9685 WP_003407562.1.97008 WP_003407562.1.97009 WP_003407562.1.97056 WP_003407562.1.97084 WP_003407562.1.97087 WP_003407562.1.97094 WP_003407562.1.97096 WP_003407562.1.97099 WP_003407562.1.97108 WP_003407562.1.97113 WP_003407562.1.97122 WP_003407562.1.97127 WP_003407562.1.97129 WP_003407562.1.97136 WP_003407562.1.9716 WP_003407562.1.97176 WP_003407562.1.97222 WP_003407562.1.97223 WP_003407562.1.97237 WP_003407562.1.97242 WP_003407562.1.97270 WP_003407562.1.97283 WP_003407562.1.97296 WP_003407562.1.97321 WP_003407562.1.97325 WP_003407562.1.97330 WP_003407562.1.97366 WP_003407562.1.97376 WP_003407562.1.97380 WP_003407562.1.9739 WP_003407562.1.97462 WP_003407562.1.97517 WP_003407562.1.97519 WP_003407562.1.97535 WP_003407562.1.97540 WP_003407562.1.97545 WP_003407562.1.97546 WP_003407562.1.97550 WP_003407562.1.97568 WP_003407562.1.97577 WP_003407562.1.97584 WP_003407562.1.9759 WP_003407562.1.97591 WP_003407562.1.97596 WP_003407562.1.97609 WP_003407562.1.97618 WP_003407562.1.9763 WP_003407562.1.97669 WP_003407562.1.97700 WP_003407562.1.97701 WP_003407562.1.9773 WP_003407562.1.97730 WP_003407562.1.97740 WP_003407562.1.97751 WP_003407562.1.97754 WP_003407562.1.97797 WP_003407562.1.9782 WP_003407562.1.9784 WP_003407562.1.97888 WP_003407562.1.9790 WP_003407562.1.9795 WP_003407562.1.97951 WP_003407562.1.97958 WP_003407562.1.97966 WP_003407562.1.97977 WP_003407562.1.97979 WP_003407562.1.97995 WP_003407562.1.98018 WP_003407562.1.98034 WP_003407562.1.98052 WP_003407562.1.98071 WP_003407562.1.98072 WP_003407562.1.98113 WP_003407562.1.98114 WP_003407562.1.98128 WP_003407562.1.98181 WP_003407562.1.98188 WP_003407562.1.98189 WP_003407562.1.98213 WP_003407562.1.98225 WP_003407562.1.98291 WP_003407562.1.98335 WP_003407562.1.98350 WP_003407562.1.98395 WP_003407562.1.98412 WP_003407562.1.98441 WP_003407562.1.98443 WP_003407562.1.98462 WP_003407562.1.9848 WP_003407562.1.98482 WP_003407562.1.98486 WP_003407562.1.98488 WP_003407562.1.98503 WP_003407562.1.98516 WP_003407562.1.98524 WP_003407562.1.98536 WP_003407562.1.98541 WP_003407562.1.98566 WP_003407562.1.98576 WP_003407562.1.98590 WP_003407562.1.98594 WP_003407562.1.98599 WP_003407562.1.98629 WP_003407562.1.98645 WP_003407562.1.98646 WP_003407562.1.98649 WP_003407562.1.98656 WP_003407562.1.9867 WP_003407562.1.98674 WP_003407562.1.98697 WP_003407562.1.98701 WP_003407562.1.98739 WP_003407562.1.98749 WP_003407562.1.98765 WP_003407562.1.98770 WP_003407562.1.98777 WP_003407562.1.98778 WP_003407562.1.98802 WP_003407562.1.98838 WP_003407562.1.98850 WP_003407562.1.98906 WP_003407562.1.98935 WP_003407562.1.98948 WP_003407562.1.98953 WP_003407562.1.98984 WP_003407562.1.99000 WP_003407562.1.99023 WP_003407562.1.99030 WP_003407562.1.99037 WP_003407562.1.99055 WP_003407562.1.99062 WP_003407562.1.99086 WP_003407562.1.99115 WP_003407562.1.99117 WP_003407562.1.99161 WP_003407562.1.99176 WP_003407562.1.99205 WP_003407562.1.99211 WP_003407562.1.99216 WP_003407562.1.99222 WP_003407562.1.99251 WP_003407562.1.99269 WP_003407562.1.99294 WP_003407562.1.99312 WP_003407562.1.99315 WP_003407562.1.99316 WP_003407562.1.99322 WP_003407562.1.99328 WP_003407562.1.99365 WP_003407562.1.99368 WP_003407562.1.99379 WP_003407562.1.99396 WP_003407562.1.99402 WP_003407562.1.99404 WP_003407562.1.99419 WP_003407562.1.99438 WP_003407562.1.99460 WP_003407562.1.99468 WP_003407562.1.99473 WP_003407562.1.99513 WP_003407562.1.99529 WP_003407562.1.99548 WP_003407562.1.99572 WP_003407562.1.99575 WP_003407562.1.99578 WP_003407562.1.99605 WP_003407562.1.99609 WP_003407562.1.99617 WP_003407562.1.99635 WP_003407562.1.99650 WP_003407562.1.99672 WP_003407562.1.99701 WP_003407562.1.99711 WP_003407562.1.99716 WP_003407562.1.99740 WP_003407562.1.99745 WP_003407562.1.99749 WP_003407562.1.9976 WP_003407562.1.99798 WP_003407562.1.99817 WP_003407562.1.99832 WP_003407562.1.99847 WP_003407562.1.99852 WP_003407562.1.99886 WP_003407562.1.99897 WP_003407562.1.99899 WP_003407562.1.99915 WP_003407562.1.9993 WP_003407562.1.99982 WP_003407562.1.99991 gi|383307349|ref|YP_005360160.1| gi|339631555|ref|YP_004723197.1| gi|494692049|ref|YP_007957592.1| gi|253799463|ref|YP_003032464.1| gi|15840948|ref|NP_335985.1| gi|392386172|ref|YP_005307801.1| gi|224989893|ref|YP_002644580.1| gi|375296706|ref|YP_005100973.1| 233413.Mb1523 336982.TBFG_11516 410289.BCG_1549 419947.MRA_1496 478434.TBMG_02494 561275.JTY_1524 83331.MT1533.1 83332.Rv1487 gi|340626502|ref|YP_004744954.1| gi|386004473|ref|YP_005922752.1| gi|506925970|ref|YP_008006420.1| gi|433626589|ref|YP_007260218.1| gi|385998272|ref|YP_005916570.1| gi|31792682|ref|NP_855175.1| gi|148822707|ref|YP_001287461.1| gi|148661280|ref|YP_001282803.1| gi|392432916|ref|YP_006473960.1| gi|197740175|ref|YP_002161489.1| gi|15608625|ref|NP_216003.1| gi|525674207|ref|YP_008225598.1| gi|471337415|ref|YP_007610128.1| gi|385990909|ref|YP_005909207.1| gi|15608625|ref|NP_216003.1| gi|378771252|ref|YP_005170985.1| gi|479055451|ref|YP_007351257.1| gi|121637418|ref|YP_977641.1| gi|494699899|ref|YP_007965381.1| gi|506925970|ref|YP_008006420.1| gi|433630596|ref|YP_007264224.1| gi|433641638|ref|YP_007287397.1| gi|449063569|ref|YP_007430652.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]