SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 478801.Ksed_18360 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  478801.Ksed_18360
Domain Number 1 Region: 79-139
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000458
Family NfeD domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 478801.Ksed_18360
Sequence length 141
Comment (Kytococcus sedentarius DSM 20547)
Sequence
MWWLGAALALGAVEMMTLDFMFLMLAIGALVAMVLAALGLGFTGQVVTFALASLLLLFLV
RPVLKRRLLENTPLAVTNAAALKGRDALVTEPVTELAGTVKLAGETWTARPQWDGETFAI
GERVRIARIEGATARIERLAA
Download sequence
Identical sequences C7NJQ8
478801.Ksed_18360 gi|256825645|ref|YP_003149605.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]