SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 478801.Ksed_24140 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  478801.Ksed_24140
Domain Number 1 Region: 93-320
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.22e-42
Family D-glucarate dehydratase-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 478801.Ksed_24140
Sequence length 357
Comment (Kytococcus sedentarius DSM 20547)
Sequence
MLPCPTDRPQAVSDPTLGRELPALEELLAHLVVVRLPMVVRFRGLTTRETALVRGPLGWA
EFAPFTEYDDAEASRWLAATLEAGWWGWPAPVRSTVPVNVTVPAVAAEEVPAVVARVPGA
GTAKIKVAERSVLDRDEAASTANDLARIAAVRRAMGPDAALRIDANGAWSVRQAARALEQ
VAATGERLDYCEQPCATAAELAELRELLVARGVPTRIAADESIRRAADPLLVRALGAADL
IVVKAAPMGGAAAAAQIITATGLPTVVSSALESSVGLGAGVALASSMPELAGACGLGTAA
LFSHDVTSAPLVPEGGRIALRRVEPDRAAELAAPDRTDWWARRIERSLELLRTGQAG
Download sequence
Identical sequences C7NFM3
gi|256826186|ref|YP_003150146.1| WP_015780310.1.81216 478801.Ksed_24140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]