SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 479431.Namu_2311 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  479431.Namu_2311
Domain Number 1 Region: 77-139
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000667
Family NfeD domain-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 479431.Namu_2311
Sequence length 143
Comment (Nakamurella multipartita DSM 44233)
Sequence
MSAWIWLVGGVLLSIAEVLGAEFVLLMLGGGALITAGFAAFFPELLWLQVLVFALSSVAL
VLGLRPMLLRRYYQPSQTRTGIDAIIGSKATVVSTVDADGGQVKIGGEVWSAVSLDGHRA
LPPGTSVTVVEVRGATAVVIWGA
Download sequence
Identical sequences C8XKC5
gi|258652520|ref|YP_003201676.1| 479431.Namu_2311 WP_015747577.1.85990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]