SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 479432.Sros_0661 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  479432.Sros_0661
Domain Number 1 Region: 233-496
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.82e-61
Family PFOR Pyr module 0.047
Further Details:      
 
Domain Number 2 Region: 13-249
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.79e-18
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.029
Further Details:      
 
Domain Number 3 Region: 514-616
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000283
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 479432.Sros_0661
Sequence length 617
Comment (Streptosporangium roseum DSM 43021)
Sequence
MTKQVQQLDRVIIRFAGDSGDGMQLTGDRFTAGTAEFGNDLSTLPNFPAEIRAPAGTLPG
VSSFQLHFADHDILTPGDAPNVLVAMNPAALKANLGDLPRGADIIANTDEFTKRNLQKVG
YDGNPLEDDSLAEWRLHPVPLTSLTVKALEGFTLSKKDAERSKNMFALGLLSWLYHRPTE
ATIQFLENKFAKKPDIAKANIAAFQAGWNYGETTESFSVSYEVKPAKLPPGVYRNISGNQ
ALAYGLIAASVQSRLPLFLGSYPITPASDILHELSKHKRFGIRTFQAEDEIAGVGAALGA
AFGGALGVTTTSGPGVALKAETVGLAVTTELPLLVVDVQRAGPSTGMPTKTEQTDLLMAM
FGRNGESPLPIVAPATPSDCFDAAIEAARLAVKYRTPVMLLSDGYLANGSEPWKVPSAAE
LPDIATEFATGPNGEDGVTFLPFKRDAETLARPWAIPGTAGLEHRIGGIEKAENTGNISY
DPNNHDKMVRLRQAKIDGIARDIPPLEVDDPDGDARVLVLGWGSTYGPIAAAVRRIRKSG
GKVAQAHLRHLNPLPANTGEVLRAYDKVLLPEINLGQLALLLRARFLVDIISYNRVRGLP
FKAEELAGVIQDVIDSE
Download sequence
Identical sequences D2B4J8
WP_012887430.1.100029 gi|271962231|ref|YP_003336427.1| 479432.Sros_0661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]