SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 479432.Sros_3354 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  479432.Sros_3354
Domain Number 1 Region: 718-917
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000000000000471
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.011
Further Details:      
 
Domain Number 2 Region: 22-205
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000247
Family Pyruvate oxidase and decarboxylase Pyr module 0.042
Further Details:      
 
Domain Number 3 Region: 434-621
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000706
Family PFOR PP module 0.054
Further Details:      
 
Domain Number 4 Region: 276-394
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000837
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 479432.Sros_3354
Sequence length 1155
Comment (Streptosporangium roseum DSM 43021)
Sequence
MTIFADAREVTPDDRYVLDEGQVFMTGTQALVRVILDQMRADRSAGLDTGTMVSGYPGSP
LGGFDQELARSHKHAGPLGVVHRPGQNEELGATAVWGSQLVPALPRPRKAGVLGVWYGKA
PGVDRAADAFRHGNFVGAHPDGGLIAFCGDDPTCKSSTLPSATESALAALGMPIVHPGSV
QELLDLGRHAISASRASGLWVAVKAVTNVVDGTGTVGVGPGRVVPVMPVVEYEGRPYRHT
PDATLLTPWSLEMERTLVGPRLELARAYARENGLNRITVDPRDAWLGIVASGTAYHDVCE
GFRRLGVDPAELGVRILKIGMLWPLEPGIVRTFARGLEEILVVEEKAPLLETLVKDVLYG
TADAPRVLGKLDENGAALIPRAGGVDADLAAKAIAFRLRRKGLDGRAEIAKGLAVISRPA
PLKLLGAERTPFFCSGCPHNRSTAVPDGAPVGAGIGCHTMVVLNREGKGTLTGLTQMGGE
GTQWIGQAPFTDTPHIFQNLGDGTFHHSGSLAVRAAVGAGVNITYKLLYNSAIAMTGGQT
ITPSLAVADLTRWLEVEGVRRVIVTTDEPERYRGIRLARIAEVRDRTALEEAQRELAAIP
GVTVLVHDQQCAAEKRRLRKKGLLPDPVRRVAINQRVCEGCGDCGQKSECLSVLPVETEF
GRKTEIHQSSCNKDYSCLEGDCPSFLTVTPGKAAGRRAAVPAPPALPAPPARTGATMIRL
VGIGGTGVVSVAQILGTAAMFDGRQSRGLDQTGLAQKGGTVVSDILIFEGDDDRSGRAGT
AGVDAYLALDLIGATDPKQLSGAGRDRTVAVVSTSLVPTGSMVLDPSTHVTDLGSPIGAL
ESRTRRELNVYLDAEDVAQKLFGDHMPANTIVVGAAWQRGLIPLSLESIERAIRLGGGRS
AERTIAAFHWGRAVVAAPESVARATGAPAPAGRPASPEVAGLVDSVAAAGTELHRILTVR
VADLVAYQNLRYATRYADAVRAVLSRERETSAERCPITEAYARHLHRLMAYKDEYEVARL
HLDPDERARIAAEFGPGAKISYNLHPPVLRALGMNRKIRLGAWFDPAFRLLYGMRGLRGT
RLDPFGMAGVRRTERELVAEYTRDVHRALSHLRPETGDRVLELAELPEVIRGYEHVKTRN
VAAYRERVAALLAAL
Download sequence
Identical sequences D2BDK4
479432.Sros_3354 WP_012890037.1.100029 gi|271964840|ref|YP_003339036.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]