SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 479432.Sros_3821 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  479432.Sros_3821
Domain Number - Region: 59-94
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.00314
Family DnaJ/Hsp40 cysteine-rich domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 479432.Sros_3821
Sequence length 130
Comment (Streptosporangium roseum DSM 43021)
Sequence
MHEFGIAEAILDAVERRADGRRVERARVHAGAMLRITEPVINQAFAMVADGSLAEGARVD
LVIVPVQLICRSCGQTATSVDPFATCPECGGSDIDTEGGDDLVLESIQMAEATHVPGNSR
RDRGNPVGPS
Download sequence
Identical sequences D2ATM1
479432.Sros_3821 WP_012890484.1.100029 gi|271965288|ref|YP_003339484.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]