SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 479432.Sros_8581 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  479432.Sros_8581
Domain Number 1 Region: 137-421
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.01e-131
Family Enolase 0.0000000236
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.01e-51
Family Enolase N-terminal domain-like 0.0000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 479432.Sros_8581
Sequence length 425
Comment (Streptosporangium roseum DSM 43021)
Sequence
MASIEGVTAREILDSRGNPTIEVDILLDDGSEARAAVPSGASTGQFEAVELRDGDERYGG
KGVEKAVLGVTDEIADEILGFDAAEQRSIDQVMIDLDGTPNKARLGANAILGVSLAVAKA
AAESAELPLFRYLGGPNAHVLPVPMMNIVNGGAHADTNVDIQEFMIAPIGAESFREAVRM
GTEVYHALKAVLKEKGYATGLGDEGGFAPNLPSNRDALDLILVAIEKAGYVPGEDIGLAL
DAAASEFYKDGLYTIDGKGLSAAELIAFYEDLVANYPLVSIEDPLDESDWEGWNALTRAI
GDKVQLVGDDLFVTNPERLSRGIAEGTANALLVKVNQIGTLTETLDAVDLAHRNGYRCMM
SHRSGETEDTTIADLAVATNCGQIKTGAPARSDRVAKYNQLLRIEELLDDAARYAGRAAF
PRFQR
Download sequence
Identical sequences D2B3Y9
479432.Sros_8581 WP_012894952.1.100029 gi|271969770|ref|YP_003343966.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]