SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 479433.Caci_5041 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  479433.Caci_5041
Domain Number 1 Region: 123-358
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.03e-63
Family D-glucarate dehydratase-like 0.0000000784
Further Details:      
 
Domain Number 2 Region: 1-124
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.94e-26
Family Enolase N-terminal domain-like 0.0000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 479433.Caci_5041
Sequence length 369
Comment (Catenulispora acidiphila DSM 44928)
Sequence
MKLERVELRRIGIPLATPFRTSLGLELDRDILILRADTSEGPGWGECVAMPEPGYSEEYL
DGAAHVIQRFLLPAVAALDDLTPARAAAAMAAFPGNPMAKATVEMAVMDAWLRARRSSYA
DHLGAVRSTVESGVSVGIADTIDQLLAEVSGYVDQGYRRIKLKIEPGWDLEPVRAIRERF
PDIALQADANAAYTFADARHLAALDAFDLVMLEQPLGTADVRDHAALARMLRTPICLDES
ITSARSAADAIALGACAIVNIKAGRVGGYLEARRIHDVCAAHSVPVWCGGMLETGLGQAA
NLALAALPGFTMPADIAPSARYFATDVTAPITMSEGRIAVPDGPGLGLDPIPEILEGYTT
DVVTITRFG
Download sequence
Identical sequences C7Q4V3
gi|256394178|ref|YP_003115742.1| WP_015793630.1.73754 479433.Caci_5041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]