SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 479433.Caci_5269 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  479433.Caci_5269
Domain Number 1 Region: 8-145
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 7.06e-38
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 479433.Caci_5269
Sequence length 153
Comment (Catenulispora acidiphila DSM 44928)
Sequence
MSDSRDGLLAERAVRFGVHATDRYDAVRQCGELLVEVGAVAEEYVPSMRDREDEISTYIG
AGVAIPHSTAAGKKYVRRDALAVLVLAEPVDWGEDQQVSLCVAIAALGDRHLDILAELAE
VLMDPERAEQLHQAKTANEVIRLLQPAGKAENV
Download sequence
Identical sequences C7Q7W1
479433.Caci_5269 gi|256394405|ref|YP_003115969.1| WP_015793857.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]