SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 479434.Sthe_1133 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  479434.Sthe_1133
Domain Number - Region: 45-120
Classification Level Classification E-value
Superfamily PKD domain 0.0163
Family PKD domain 0.0043
Further Details:      
 
Domain Number - Region: 136-275
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0665
Family Alginate lyase 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 479434.Sthe_1133
Sequence length 286
Comment (Sphaerobacter thermophilus DSM 20745)
Sequence
MDIRRLLSIVMIVLVAVAAGVIGVLVADQVRGPTVPEPTPVPTEAPTSTPLPGPSAVPPP
QLVWAADLESGDLSSWEADGCGGEFNTGNGEARVTDAVAHSGRYSVELSVATDNGTDNAT
RLMRWCEPSEHDAAYFSAWYYFPQHVDVSAGWWNIFQFKSRNETANDPWWILNVGNREDG
TMYVYLRDWIHEVSYDQYVKDLPVGQWVHFEVFLRRAQDPTGEIMVWQDGTLLFHITNVQ
TNYDSGRVSWGVNSYSSGLNPSPTVIYIDDVVMSTTPVGHGTSAGS
Download sequence
Identical sequences D1C2V2
479434.Sthe_1133 gi|269837163|ref|YP_003319391.1| WP_012871616.1.32378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]